Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016450
Gene name
Locationscaffold_10:415859..417486
Strand-
Gene length (bp)1627
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.1E-08 59 135

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.684 0.6033 0.0873 0.0576 0.2616 0.0063 0.0763 0.1771 0.1039 0.0043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup244
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016410
Agaricus bisporus var bisporus H39 AgabiH39|356900
Agaricus bisporus var bisporus H39 AgabiH39|099680
Agaricus bisporus var bisporus H39 AgabiH39|096020
Agaricus bisporus var bisporus H39 AgabiH39|096000
Agaricus bisporus var bisporus H39 AgabiH39|095890
Agaricus bisporus var bisporus H39 AgabiH39|095880
Agaricus bisporus var bisporus H39 AgabiH39|095450
Agaricus bisporus var bisporus H39 AgabiH39|086600
Agaricus bisporus var bisporus H39 AgabiH39|086590
Agaricus bisporus var bisporus H39 AgabiH39|357400
Agaricus bisporus var bisporus H39 AgabiH39|086500
Agaricus bisporus var bisporus H39 AgabiH39|029400
Agaricus bisporus var bisporus H39 AgabiH39|019480
Agaricus bisporus var bisporus H39 AgabiH39|019400
Agaricus bisporus var bisporus H39 AgabiH39|019380
Agaricus bisporus var bisporus H39 AgabiH39|019370
Agaricus bisporus var bisporus H39 AgabiH39|019360
Agaricus bisporus var bisporus H39 AgabiH39|016460
Agaricus bisporus var bisporus H39 AgabiH39|016450
Agaricus bisporus var bisporus H39 AgabiH39|086550
Agaricus bisporus var bisporus H97 AgabiH97|086590
Agaricus bisporus var bisporus H97 AgabiH97|086600
Agaricus bisporus var bisporus H97 AgabiH97|086950
Agaricus bisporus var bisporus H97 AgabiH97|096000
Agaricus bisporus var bisporus H97 AgabiH97|095880
Agaricus bisporus var bisporus H97 AgabiH97|095890
Agaricus bisporus var bisporus H97 AgabiH97|086550
Agaricus bisporus var bisporus H97 AgabiH97|095450
Agaricus bisporus var bisporus H97 AgabiH97|086500
Agaricus bisporus var bisporus H97 AgabiH97|019370
Agaricus bisporus var bisporus H97 AgabiH97|019480
Agaricus bisporus var bisporus H97 AgabiH97|019400
Agaricus bisporus var bisporus H97 AgabiH97|019380
Agaricus bisporus var bisporus H97 AgabiH97|019360
Agaricus bisporus var bisporus H97 AgabiH97|016460
Agaricus bisporus var bisporus H97 AgabiH97|016450 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|016410
Agaricus bisporus var bisporus H97 AgabiH97|096020
Agaricus bisporus var bisporus H97 AgabiH97|029400
Agaricus bisporus var bisporus H97 AgabiH97|099680

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016450
MSIAECPRCGYHLAKVEVKVEEVLALQAEVRRLKDLIPRLQEETAVLLRRINDAQEKTRNLPFEVLSKIFLFVRP
PIDFTAHEPKIYGVDDPSRPPLTGYHDPAEDFHYTLAAVSHRWRQVVFSTPQLWTSISLRVLNTSTEFNTSLLDL
HFKNASDLPISIQIDFSNPTFLFDSDPSQRSDTLVRLQPLAKVMFGENSDQVQSLFLIQPPAEWLSFVGGSLSRC
KSITTYWPSSEPHCKYFFNFHDLPCLQHVKLIGSDFPLNLPTTTSSLQLSFIELYKSIRLLMELPNLVTFESTHH
WNESLDYGDVTKPIVLHCLENLTWDAQHIDYMHGFLRHVRFDNLRTLQWYEGRLFWSGASEEAESLRLAFFSALP
PTLSSLTFNETALHSHAILNLLYRVPQLTELHFINYHSSVVEDTIKAIGRPLTNTGTPSSSELTVLPNLCVLSLS
NAKNGGTLKPFVLIQLLETLLNAASPRPRQFHLTTHSEVTWHSDALDKVRTLLSSGLNAKITFDVDGFKSEMS*
Coding >AgabiH97|016450
ATGTCCATTGCGGAATGTCCTCGTTGTGGTTATCATCTCGCGAAAGTTGAAGTAAAGGTTGAAGAAGTCCTCGCC
CTTCAGGCTGAGGTCCGCCGTCTGAAGGACCTGATTCCCCGTCTTCAAGAAGAGACAGCTGTTCTTTTGCGCAGA
ATAAACGACGCTCAAGAAAAAACGAGAAATCTGCCGTTTGAAGTGTTGTCGAAGATCTTTCTGTTTGTTCGTCCG
CCGATTGACTTCACCGCCCACGAGCCGAAAATCTATGGTGTTGATGACCCAAGCCGCCCACCATTGACAGGATAT
CATGATCCTGCCGAGGACTTCCATTACACTTTGGCGGCTGTGTCTCATCGTTGGCGCCAGGTCGTGTTCTCAACT
CCACAACTCTGGACTTCAATCTCGCTTCGTGTTCTTAATACAAGCACCGAATTCAACACGTCACTCCTCGATCTA
CATTTCAAAAATGCGAGTGACCTTCCGATCTCAATTCAAATCGACTTCAGTAATCCTACATTTTTGTTTGATAGC
GATCCTTCACAACGTTCAGACACCCTCGTGCGTCTACAACCTCTTGCCAAAGTCATGTTCGGAGAGAATTCGGAC
CAAGTACAAAGCCTCTTTCTCATCCAGCCACCGGCTGAATGGTTGTCTTTCGTCGGTGGCAGCCTATCGCGTTGC
AAATCTATAACAACTTATTGGCCAAGTTCGGAGCCTCACTGCAAGTACTTCTTTAACTTCCATGATCTTCCTTGT
CTCCAGCATGTGAAGCTGATCGGCAGTGATTTTCCACTCAATTTGCCTACTACAACATCTTCTCTACAGTTATCC
TTCATCGAATTATACAAGTCCATTCGATTACTCATGGAATTACCAAATCTCGTTACATTCGAGAGTACTCATCAC
TGGAACGAATCTTTGGATTACGGAGATGTCACTAAACCCATAGTACTTCATTGTCTCGAAAACTTGACATGGGAT
GCACAACACATAGACTATATGCATGGCTTTCTGCGCCATGTTCGTTTCGACAACCTTCGCACGTTACAATGGTAT
GAAGGCAGGCTCTTTTGGAGTGGCGCTTCCGAAGAAGCCGAGAGTTTACGACTTGCCTTCTTTTCCGCACTTCCA
CCCACTCTTTCGTCCCTGACCTTCAACGAAACCGCGCTCCATTCTCATGCCATACTCAATCTACTGTATCGCGTC
CCTCAACTGACCGAACTCCACTTCATCAACTATCATTCTTCGGTTGTTGAAGACACCATCAAGGCGATTGGACGG
CCCCTCACAAATACAGGGACACCGTCTTCGTCCGAGTTGACTGTTCTGCCAAACCTTTGTGTTTTGTCTCTCTCA
AACGCCAAAAACGGTGGGACGCTCAAGCCGTTTGTACTCATTCAATTGCTGGAAACACTGCTAAACGCTGCTAGC
CCACGACCAAGACAATTCCATTTAACCACTCATTCTGAAGTGACTTGGCATTCAGATGCCTTGGACAAAGTTCGG
ACACTATTGTCTTCCGGTTTGAATGCGAAGATCACATTTGATGTTGATGGTTTCAAGTCAGAGATGTCTTAG
Transcript >AgabiH97|016450
ATGTCCATTGCGGAATGTCCTCGTTGTGGTTATCATCTCGCGAAAGTTGAAGTAAAGGTTGAAGAAGTCCTCGCC
CTTCAGGCTGAGGTCCGCCGTCTGAAGGACCTGATTCCCCGTCTTCAAGAAGAGACAGCTGTTCTTTTGCGCAGA
ATAAACGACGCTCAAGAAAAAACGAGAAATCTGCCGTTTGAAGTGTTGTCGAAGATCTTTCTGTTTGTTCGTCCG
CCGATTGACTTCACCGCCCACGAGCCGAAAATCTATGGTGTTGATGACCCAAGCCGCCCACCATTGACAGGATAT
CATGATCCTGCCGAGGACTTCCATTACACTTTGGCGGCTGTGTCTCATCGTTGGCGCCAGGTCGTGTTCTCAACT
CCACAACTCTGGACTTCAATCTCGCTTCGTGTTCTTAATACAAGCACCGAATTCAACACGTCACTCCTCGATCTA
CATTTCAAAAATGCGAGTGACCTTCCGATCTCAATTCAAATCGACTTCAGTAATCCTACATTTTTGTTTGATAGC
GATCCTTCACAACGTTCAGACACCCTCGTGCGTCTACAACCTCTTGCCAAAGTCATGTTCGGAGAGAATTCGGAC
CAAGTACAAAGCCTCTTTCTCATCCAGCCACCGGCTGAATGGTTGTCTTTCGTCGGTGGCAGCCTATCGCGTTGC
AAATCTATAACAACTTATTGGCCAAGTTCGGAGCCTCACTGCAAGTACTTCTTTAACTTCCATGATCTTCCTTGT
CTCCAGCATGTGAAGCTGATCGGCAGTGATTTTCCACTCAATTTGCCTACTACAACATCTTCTCTACAGTTATCC
TTCATCGAATTATACAAGTCCATTCGATTACTCATGGAATTACCAAATCTCGTTACATTCGAGAGTACTCATCAC
TGGAACGAATCTTTGGATTACGGAGATGTCACTAAACCCATAGTACTTCATTGTCTCGAAAACTTGACATGGGAT
GCACAACACATAGACTATATGCATGGCTTTCTGCGCCATGTTCGTTTCGACAACCTTCGCACGTTACAATGGTAT
GAAGGCAGGCTCTTTTGGAGTGGCGCTTCCGAAGAAGCCGAGAGTTTACGACTTGCCTTCTTTTCCGCACTTCCA
CCCACTCTTTCGTCCCTGACCTTCAACGAAACCGCGCTCCATTCTCATGCCATACTCAATCTACTGTATCGCGTC
CCTCAACTGACCGAACTCCACTTCATCAACTATCATTCTTCGGTTGTTGAAGACACCATCAAGGCGATTGGACGG
CCCCTCACAAATACAGGGACACCGTCTTCGTCCGAGTTGACTGTTCTGCCAAACCTTTGTGTTTTGTCTCTCTCA
AACGCCAAAAACGGTGGGACGCTCAAGCCGTTTGTACTCATTCAATTGCTGGAAACACTGCTAAACGCTGCTAGC
CCACGACCAAGACAATTCCATTTAACCACTCATTCTGAAGTGACTTGGCATTCAGATGCCTTGGACAAAGTTCGG
ACACTATTGTCTTCCGGTTTGAATGCGAAGATCACATTTGATGTTGATGGTTTCAAGTCAGAGATGTCTTAG
Gene >AgabiH97|016450
ATGTCCATTGCGGAATGTCCTCGTTGTGGTTATCATCTCGCGAAAGTTGAAGTAAAGGTACACCGCCCCCGACAT
TCATTTCTCAAATGACGTGACTGAATAGGGCCGTCAGGTTGAAGAAGTCCTCGCCCTTCAGGCTGAGGTCCGCCG
TCTGAAGGACCTGATTCCCCGTCTTCAAGAAGAGACAGCTGTTCTTTTGCGCAGAATAAACGACGCTCAAGAAAA
AACGAGAAATCTGCCGTTTGAAGTGTTGTCGAAGATCTTTCTGTTTGTTCGTCCGCCGATTGACTTCACCGCCCA
CGAGCCGAAAATCTATGGTGTTGATGACCCAAGCCGCCCACCATTGACAGGATATCATGATCCTGCCGAGGACTT
CCATTACACTTTGGCGGCTGTGTCTCATCGTTGGCGCCAGGTCGTGTTCTCAACTCCACAACTCTGGACTTCAAT
CTCGCTTCGTGTTCTTAATACAAGCACCGAATTCAACACGTCACTCCTCGATCTACATTTCAAAAATGCGAGTGA
CCTTCCGATCTCAATTCAAATCGACTTCAGTAATCCTACATTTTTGTTTGATAGCGATCCTTCACAACGTTCAGA
CACCCTCGTGCGTCTACAACCTCTTGCCAAAGTCATGTTCGGAGAGAATTCGGACCAAGTACAAAGCCTCTTTCT
CATCCAGCCACCGGCTGAATGGTTGTCTTTCGTCGGTGGCAGCCTATCGCGTTGCAAATCTATAACAACTTATTG
GCCAAGTTCGGAGCCTCACTGCAAGTACTTCTTTAACTTCCATGATCTTCCTTGTCTCCAGCATGTGAAGCTGAT
CGGCAGTGATTTTCCACTCAATTTGCCTACTACAACATCTTCTCTACAGTTATCCTTCATCGAATTATACAAGTC
CATTCGATTACTCATGGAATTACCAAATCTCGTTACATTCGAGAGTACTCATCACTGGAACGAATCTTTGGATTA
CGGAGATGTCACTAAACCCATAGTACTTCATTGTCTCGAAAACTTGACATGGGATGCACAACACATAGACTATAT
GCATGGCTTTCTGCGCCATGTTCGTTTCGACAACCTTCGCACGTTACAATGGTATGAAGGCAGGCTCTTTTGGAG
TGGCGCTTCCGAAGAAGCCGAGAGTTTACGACTTGCCTTCTTTTCCGCACTTCCACCCACTCTTTCGTCCCTGAC
CTTCAACGAAACCGCGCTCCATTCTCATGCCATACTCAATCTACTGTATCGCGTCCCTCAACTGACCGAACTCCA
CTTCATCAACTATCATTCTTCGGTTGTTGAAGACACCATCAAGGCGATTGGACGGCCCCTCACAAATACAGGGAC
ACCGTCTTCGTCCGAGTTGACTGTTCTGCCAAACCTTTGTGTTTTGTCTCTCTCAAACGCCAAAAACGGTGGGAC
GCTCAAGCCGTTTGTACTCATTCAATTGCTGGAAACACTGCTAAACGCTGCTAGCCCACGACCAAGACAATTCCA
TTTAACCACTCATTCTGAAGTGACTTGGCATTCAGATGCCTTGGACAAAGTTCGGACACTATTGTCTTCCGGTTT
GAATGCGAAGATCACATTTGATGTTGATGGTTTCAAGTCAGAGATGTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail