Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016340
Gene name
Locationscaffold_10:393080..393554
Strand+
Gene length (bp)474
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 3.9E-18 39 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 115 1.0E-21
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 13 115 2.0E-17
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 113 3.0E-14
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 37 115 4.0E-14
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 1 115 9.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 115 1.0E-21
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 13 115 2.0E-17
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 113 3.0E-14
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 37 115 4.0E-14
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 1 115 9.0E-13
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 37 115 2.0E-12
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 25 115 5.0E-12
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 38 114 2.0E-10
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 39 113 1.0E-07
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 31 114 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 586.70 350.91 822.50
Initials Initials knots 55.04 24.11 85.97
Pileal_Stipeal_center Stage I stipe center 5.63 0.69 10.56
Pileal_Stipeal_shell Stage I stipe shell 10.23 3.00 17.46
DIF_stipe_center Stage II stipe center 1.27 0.00 2.99
DIF_stipe_shell Stage II stipe shell 0.99 0.00 2.45
DIF_stipe_skin Stage II stipe skin 3.30 0.15 6.45
DIF_cap_skin Stage II cap skin 5.20 0.72 9.68
DIF_cap_tissue Stage II cap tissue 6.08 1.11 11.05
DIF_gill_tissue Stage II gill tissue 9.40 2.64 16.15
YFB_stipe_center Young fruiting body stipe center 1.55 0.00 3.48
YFB_stipe_shell Young fruiting body stipe shell 1.72 0.00 3.73
YFB_stipe_skin Young fruiting body stipe skin 9.66 2.58 16.74
YFB_cap_skin Young fruiting body cap skin 4.36 0.41 8.31
YFB_cap_tissue Young fruiting body cap tissue 1.51 0.00 3.45
YFB_gill_tissue Young fruiting body gill tissue 2.40 0.00 4.87
YFB_veil Young fruiting body veil 4.73 0.00 9.57

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.002951 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.004928 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.011659 yes
Casing DIF_stipe_shell 0.023153 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.041603 yes
DIF_gill_tissue YFB_stipe_shell 0.037364 yes
DIF_gill_tissue YFB_stipe_skin 0.979259 no
DIF_gill_tissue YFB_cap_skin 0.215732 no
DIF_gill_tissue YFB_cap_tissue 0.051115 no
DIF_gill_tissue YFB_gill_tissue 0.047584 yes
DIF_gill_tissue YFB_veil 0.328610 no
YFB_stipe_center YFB_stipe_shell 0.953111 no
YFB_stipe_center YFB_stipe_skin 0.039836 yes
YFB_stipe_center YFB_cap_skin 0.241143 no
YFB_stipe_center YFB_cap_tissue 0.978981 no
YFB_stipe_center YFB_gill_tissue 0.724552 no
YFB_stipe_center YFB_veil 0.215396 no
YFB_stipe_shell YFB_stipe_skin 0.042260 yes
YFB_stipe_shell YFB_cap_skin 0.285239 no
YFB_stipe_shell YFB_cap_tissue 0.943487 no
YFB_stipe_shell YFB_gill_tissue 0.800038 no
YFB_stipe_shell YFB_veil 0.260183 no
YFB_stipe_skin YFB_cap_skin 0.204693 no
YFB_stipe_skin YFB_cap_tissue 0.049674 yes
YFB_stipe_skin YFB_gill_tissue 0.043339 yes
YFB_stipe_skin YFB_veil 0.312782 no
YFB_cap_skin YFB_cap_tissue 0.247691 no
YFB_cap_skin YFB_gill_tissue 0.493298 no
YFB_cap_skin YFB_veil 0.951836 no
YFB_cap_tissue YFB_gill_tissue 0.712265 no
YFB_cap_tissue YFB_veil 0.225264 no
YFB_gill_tissue YFB_veil 0.450877 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.002951 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.004928 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.011659 yes
Initials DIF_stipe_shell 0.023153 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.434560 no
Pileal_Stipeal_center YFB_stipe_center 0.132559 no
Pileal_Stipeal_center YFB_stipe_shell 0.145790 no
Pileal_Stipeal_center YFB_stipe_skin 0.429185 no
Pileal_Stipeal_center YFB_cap_skin 0.804326 no
Pileal_Stipeal_center YFB_cap_tissue 0.146187 no
Pileal_Stipeal_center YFB_gill_tissue 0.261959 no
Pileal_Stipeal_center YFB_veil 0.884948 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.338858 no
Pileal_Stipeal_center DIF_stipe_center 0.117937 no
Pileal_Stipeal_center DIF_stipe_shell 0.084360 no
Pileal_Stipeal_center DIF_stipe_skin 0.497812 no
Pileal_Stipeal_center DIF_cap_skin 0.948000 no
Pileal_Stipeal_center DIF_cap_tissue 0.947700 no
Pileal_Stipeal_shell DIF_gill_tissue 0.925586 no
Pileal_Stipeal_shell YFB_stipe_center 0.037593 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.031800 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.954848 no
Pileal_Stipeal_shell YFB_cap_skin 0.159322 no
Pileal_Stipeal_shell YFB_cap_tissue 0.044631 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.035309 yes
Pileal_Stipeal_shell YFB_veil 0.258519 no
Pileal_Stipeal_shell DIF_stipe_center 0.036683 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.034604 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.054982 no
Pileal_Stipeal_shell DIF_cap_skin 0.271949 no
Pileal_Stipeal_shell DIF_cap_tissue 0.418605 no
DIF_stipe_center DIF_gill_tissue 0.049046 yes
DIF_stipe_center YFB_stipe_center 0.910244 no
DIF_stipe_center YFB_stipe_shell 0.844801 no
DIF_stipe_center YFB_stipe_skin 0.046327 yes
DIF_stipe_center YFB_cap_skin 0.189035 no
DIF_stipe_center YFB_cap_tissue 0.925892 no
DIF_stipe_center YFB_gill_tissue 0.581652 no
DIF_stipe_center YFB_veil 0.171137 no
DIF_stipe_center DIF_stipe_shell 0.888139 no
DIF_stipe_center DIF_stipe_skin 0.327387 no
DIF_stipe_center DIF_cap_skin 0.133289 no
DIF_stipe_center DIF_cap_tissue 0.102993 no
DIF_stipe_shell DIF_gill_tissue 0.039165 yes
DIF_stipe_shell YFB_stipe_center 0.761105 no
DIF_stipe_shell YFB_stipe_shell 0.679155 no
DIF_stipe_shell YFB_stipe_skin 0.038720 yes
DIF_stipe_shell YFB_cap_skin 0.124703 no
DIF_stipe_shell YFB_cap_tissue 0.775358 no
DIF_stipe_shell YFB_gill_tissue 0.401082 no
DIF_stipe_shell YFB_veil 0.113810 no
DIF_stipe_shell DIF_stipe_skin 0.216986 no
DIF_stipe_shell DIF_cap_skin 0.093337 no
DIF_stipe_shell DIF_cap_tissue 0.066767 no
DIF_stipe_skin DIF_gill_tissue 0.082277 no
DIF_stipe_skin YFB_stipe_center 0.429185 no
DIF_stipe_skin YFB_stipe_shell 0.486443 no
DIF_stipe_skin YFB_stipe_skin 0.078590 no
DIF_stipe_skin YFB_cap_skin 0.783030 no
DIF_stipe_skin YFB_cap_tissue 0.422572 no
DIF_stipe_skin YFB_gill_tissue 0.768994 no
DIF_stipe_skin YFB_veil 0.726368 no
DIF_stipe_skin DIF_cap_skin 0.597707 no
DIF_stipe_skin DIF_cap_tissue 0.402843 no
DIF_cap_skin DIF_gill_tissue 0.358922 no
DIF_cap_skin YFB_stipe_center 0.162901 no
DIF_cap_skin YFB_stipe_shell 0.174631 no
DIF_cap_skin YFB_stipe_skin 0.350576 no
DIF_cap_skin YFB_cap_skin 0.871271 no
DIF_cap_skin YFB_cap_tissue 0.172433 no
DIF_cap_skin YFB_gill_tissue 0.332993 no
DIF_cap_skin YFB_veil 0.941897 no
DIF_cap_skin DIF_cap_tissue 0.882429 no
DIF_cap_tissue DIF_gill_tissue 0.520960 no
DIF_cap_tissue YFB_stipe_center 0.112576 no
DIF_cap_tissue YFB_stipe_shell 0.121114 no
DIF_cap_tissue YFB_stipe_skin 0.509833 no
DIF_cap_tissue YFB_cap_skin 0.712643 no
DIF_cap_tissue YFB_cap_tissue 0.117477 no
DIF_cap_tissue YFB_gill_tissue 0.210312 no
DIF_cap_tissue YFB_veil 0.809581 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016340
MYSKLALFVLSAFALGVVAADEPAAAPAPPPPVINNSQCDVGKVQCCQSMQDVKSSAVQTLAHSLGVDLGGVTGL
VGLTCNVLGGSSCSAQPVCCDKNHFGGLIAVGCSPVNVSL*
Coding >AgabiH97|016340
ATGTACTCCAAGCTCGCTCTCTTCGTCCTCTCCGCTTTTGCTCTCGGCGTTGTCGCAGCCGATGAGCCTGCTGCT
GCCCCCGCTCCTCCCCCCCCTGTTATCAACAACTCCCAGTGCGACGTTGGAAAAGTCCAGTGCTGTCAATCCATG
CAAGATGTCAAGTCCTCGGCCGTTCAAACACTCGCTCACTCGCTCGGTGTTGACCTCGGAGGTGTTACTGGTCTA
GTCGGTCTCACCTGTAACGTCCTCGGTGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCGATAAGAACCACTTC
GGAGGCCTCATCGCTGTTGGCTGCTCCCCCGTCAACGTCAGCCTCTAG
Transcript >AgabiH97|016340
ATGTACTCCAAGCTCGCTCTCTTCGTCCTCTCCGCTTTTGCTCTCGGCGTTGTCGCAGCCGATGAGCCTGCTGCT
GCCCCCGCTCCTCCCCCCCCTGTTATCAACAACTCCCAGTGCGACGTTGGAAAAGTCCAGTGCTGTCAATCCATG
CAAGATGTCAAGTCCTCGGCCGTTCAAACACTCGCTCACTCGCTCGGTGTTGACCTCGGAGGTGTTACTGGTCTA
GTCGGTCTCACCTGTAACGTCCTCGGTGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCGATAAGAACCACTTC
GGAGGCCTCATCGCTGTTGGCTGCTCCCCCGTCAACGTCAGCCTCTAG
Gene >AgabiH97|016340
ATGTACTCCAAGCTCGCTCTCTTCGTCCTCTCCGCTTTTGCTCTCGGCGTTGTCGCAGCCGATGAGCCTGCTGCT
GCCCCCGCTCCTCCCCCCCCTGTTATCAACAACTCCCAGTGCGACGTTGGAAAAGTCCAGTGCTGTTAGTCATAT
ATATTGCGTCTCATTAACTACTAGAAAATCTGATAATTCTTACTTTTTGAAGGTCAATCCATGCAAGATGTCAAG
TCCTCGGCCGTTCAAACACTCGCTCACTCGCTCGGTGTTGACCTCGGAGGTGTTACTGGTCTAGTCGGTCTCACC
TGTAACGTCCTCGGTGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCGATAAGAACCACTTCGGTAAGTATTTG
TGATCGAAATCATGGTGGATGATTGAGAATACTAATATATTGGTTTCTTTAGGAGGCCTCATCGCTGTTGGCTGC
TCCCCCGTCAACGTCAGCCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail