Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016260
Gene name
Locationscaffold_10:361601..363230
Strand+
Gene length (bp)1629
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 7.3E-14 72 207
PF20434 BD-FAE BD-FAE 1.4E-13 53 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q566U4|KFA_DANRE Kynurenine formamidase OS=Danio rerio GN=afmid PE=2 SV=2 8 228 9.0E-09
sp|Q9ZQ91|CXE7_ARATH Probable carboxylesterase 7 OS=Arabidopsis thaliana GN=CXE7 PE=2 SV=1 68 208 5.0E-08
sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 55 219 2.0E-07
sp|Q9SMM9|CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana GN=CXE13 PE=1 SV=1 38 198 3.0E-06
sp|P14326|VSH5_DICDI Vegetative-specific protein H5 OS=Dictyostelium discoideum GN=cinB PE=2 SV=2 10 238 5.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q566U4|KFA_DANRE Kynurenine formamidase OS=Danio rerio GN=afmid PE=2 SV=2 8 228 9.0E-09
sp|Q9ZQ91|CXE7_ARATH Probable carboxylesterase 7 OS=Arabidopsis thaliana GN=CXE7 PE=2 SV=1 68 208 5.0E-08
sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 55 219 2.0E-07
sp|Q9SMM9|CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana GN=CXE13 PE=1 SV=1 38 198 3.0E-06
sp|P14326|VSH5_DICDI Vegetative-specific protein H5 OS=Dictyostelium discoideum GN=cinB PE=2 SV=2 10 238 5.0E-06
sp|Q9SX78|CXE2_ARATH Probable carboxylesterase 2 OS=Arabidopsis thaliana GN=CXE2 PE=2 SV=1 55 198 5.0E-06
sp|Q5NUF4|HIDM_GLYEC 2-hydroxyisoflavanone dehydratase OS=Glycyrrhiza echinata GN=HIDM PE=1 SV=1 55 179 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016260
MDQLTDIPWNVSPRLTRDPTLEAFRPLLEKNRSLITEIAKKTFKYGDTDRHFLDIYWPPVQPTSSNGKTPILFYV
YGGGFVAGDRNSLPPFDLMLSSLGAFFARRGFITIIPDYQLAPEFKYPTPVEDILNAIKWTLNHGSELTTPTTVD
PDLDSLTLAGHSTGAVHIATLILHPTLIPLESDLRKKIKGVVLMSSPYHFPPITENQVFVAYYGTEKYAREKSPL
SLLLNWIDTNPKESLPNILLVEAQYEPDWIFDMGVDYQKVLEWHLGEAVPMIIGKRHNHISLICSPSSGEGEEWG
VETVEWIWKNLKGVSAVGSGISAGSGADTTKHATDDECSECHQRRNRSFTVQLGTESVSSKTFMTCINCGNNIQS
KSPVIFFGSTHIRRLPDAF*
Coding >AgabiH97|016260
ATGGATCAGCTCACGGATATCCCTTGGAATGTGAGCCCGAGACTTACTCGGGATCCCACACTGGAAGCTTTTCGA
CCATTGCTTGAGAAAAACCGATCGCTCATCACTGAGATTGCCAAAAAGACCTTCAAGTATGGAGATACTGATCGA
CACTTCCTCGACATCTATTGGCCTCCTGTTCAGCCAACGTCATCCAATGGTAAAACTCCGATACTATTCTATGTG
TACGGGGGAGGTTTCGTTGCCGGAGATCGCAACAGCCTTCCGCCGTTTGATCTCATGTTAAGCTCCCTTGGTGCT
TTCTTCGCAAGACGAGGATTCATCACGATCATTCCTGACTATCAACTCGCTCCGGAGTTCAAGTACCCAACGCCT
GTTGAGGACATTCTGAATGCGATCAAGTGGACGCTCAATCATGGATCGGAGCTCACAACGCCGACTACAGTTGAC
CCAGACCTCGATTCGTTGACTCTAGCAGGGCATTCGACTGGAGCAGTTCATATCGCAACGTTAATCCTTCATCCC
ACTTTGATTCCACTCGAGTCGGACCTACGCAAGAAAATCAAAGGTGTCGTCTTGATGTCAAGCCCCTACCATTTC
CCACCAATTACGGAAAATCAAGTCTTTGTGGCGTACTATGGCACAGAAAAATATGCGAGGGAAAAATCTCCCCTT
TCACTTCTCCTCAATTGGATCGACACAAATCCAAAGGAAAGCTTACCGAATATCTTATTAGTCGAAGCGCAATAC
GAGCCAGACTGGATTTTCGACATGGGTGTCGACTATCAGAAAGTTTTGGAATGGCATTTAGGTGAAGCTGTGCCG
ATGATTATTGGTAAAAGACATAATCACATCAGTCTAATTTGTTCGCCGTCGAGCGGAGAAGGAGAAGAATGGGGT
GTGGAAACTGTGGAGTGGATATGGAAGAACCTGAAGGGTGTGTCGGCGGTAGGTAGTGGGATTAGTGCGGGGAGT
GGAGCAGACACCACGAAACATGCGACAGACGATGAGTGTTCGGAATGTCACCAACGGAGGAATCGTTCATTCACA
GTTCAACTTGGCACGGAATCGGTTTCTTCAAAGACGTTCATGACATGTATTAATTGCGGAAATAATATTCAGAGT
AAATCTCCTGTCATATTTTTTGGAAGCACGCACATTAGACGTTTACCCGATGCTTTCTAA
Transcript >AgabiH97|016260
ATGGATCAGCTCACGGATATCCCTTGGAATGTGAGCCCGAGACTTACTCGGGATCCCACACTGGAAGCTTTTCGA
CCATTGCTTGAGAAAAACCGATCGCTCATCACTGAGATTGCCAAAAAGACCTTCAAGTATGGAGATACTGATCGA
CACTTCCTCGACATCTATTGGCCTCCTGTTCAGCCAACGTCATCCAATGGTAAAACTCCGATACTATTCTATGTG
TACGGGGGAGGTTTCGTTGCCGGAGATCGCAACAGCCTTCCGCCGTTTGATCTCATGTTAAGCTCCCTTGGTGCT
TTCTTCGCAAGACGAGGATTCATCACGATCATTCCTGACTATCAACTCGCTCCGGAGTTCAAGTACCCAACGCCT
GTTGAGGACATTCTGAATGCGATCAAGTGGACGCTCAATCATGGATCGGAGCTCACAACGCCGACTACAGTTGAC
CCAGACCTCGATTCGTTGACTCTAGCAGGGCATTCGACTGGAGCAGTTCATATCGCAACGTTAATCCTTCATCCC
ACTTTGATTCCACTCGAGTCGGACCTACGCAAGAAAATCAAAGGTGTCGTCTTGATGTCAAGCCCCTACCATTTC
CCACCAATTACGGAAAATCAAGTCTTTGTGGCGTACTATGGCACAGAAAAATATGCGAGGGAAAAATCTCCCCTT
TCACTTCTCCTCAATTGGATCGACACAAATCCAAAGGAAAGCTTACCGAATATCTTATTAGTCGAAGCGCAATAC
GAGCCAGACTGGATTTTCGACATGGGTGTCGACTATCAGAAAGTTTTGGAATGGCATTTAGGTGAAGCTGTGCCG
ATGATTATTGGTAAAAGACATAATCACATCAGTCTAATTTGTTCGCCGTCGAGCGGAGAAGGAGAAGAATGGGGT
GTGGAAACTGTGGAGTGGATATGGAAGAACCTGAAGGGTGTGTCGGCGGTAGGTAGTGGGATTAGTGCGGGGAGT
GGAGCAGACACCACGAAACATGCGACAGACGATGAGTGTTCGGAATGTCACCAACGGAGGAATCGTTCATTCACA
GTTCAACTTGGCACGGAATCGGTTTCTTCAAAGACGTTCATGACATGTATTAATTGCGGAAATAATATTCAGAGT
AAATCTCCTGTCATATTTTTTGGAAGCACGCACATTAGACGTTTACCCGATGCTTTCTAA
Gene >AgabiH97|016260
ATGGATCAGCTCACGGATATCCCTTGGAATGTGAGCCCGAGACTTACTCGGGATCCCAGTACGTGGGGCAATGGC
TATGGCCGACATCTATATCTTAACCATTTTCGTGACACAGCACTGGAAGCTTTTCGACCATTGCTTGAGAAAAAC
CGATCGCTCATCACTGAGATTGCCAAAAAGACCTTCAAGTATGGAGATACTGATCGACACTTCGTGCGTACTTGC
CTTAATCGAATCAAAGTTGCGAGCCTCAAATAGTTACATCATAAAGCTCGACATCTATTGGCCTCCTGTTCAGCC
AACGTCATCCAATGGTAAAACTCCGATACTATTCTATGTGTACGGGGGAGGTTTCGTTGCCGGAGATCGCAACAG
CCTTCCGCCGTTTGATCTCATGTTAAGCTCCCTTGGTGCTTTCTTCGCAAGACGAGGATTCATCACGATCATTCC
TGACTATCAACTCGCTCCGGAGTTCAAGTACCCAACGCCTGTTGAGGACATTCTGAATGCGATCAAGTGGACGCT
CAATCATGGATCGGAGCTCACAACGCCGACTACAGTTGACCCAGACCTCGATTCGTTGACTCTAGCAGGGCATTC
GACTGGAGCAGTTCATATCGCAACGTTAATCCTTCATCCCACTTTGATTCCACTCGAGTCGGACCTACGCAAGAA
AATCAAAGGTGTCGTCTTGATGTCAAGCCCCTACCATTTCCCACCAATTACGGAAAATCAAGTCTTTGTGGCGTA
CTATGGCACAGAAAAATATGCGAGGGAAAAATCTCCCCTTTCACTTCTCCTCAATTGGATCGACACAAATCCAAA
GGAAAGCTTACCGAATATCTTATTAGTCGAAGCGCAATACGAGCCAGACTGGATTTTCGACATGGGTGTCGACTA
TCAGAAAGTTTTGGAATGGCATTTAGGTGAAGCTGTGCCGATGATTATTGGTAAAAGACATAATCACATCAGTCT
AATTTGTTCGCCGTCGAGCGGAGAAGGAGAAGAATGGGGTGTGGAAACTGTGGAGTGGATATGGAAGAACCTGAA
GGTGAGGCATAGTTCCATACATTCAAATTTCTAGCGTGTACGACTAACAGCGCATTATTGTCAGGGTGTGTCGGC
GGTAGGTAGTGGGATTAGTGCGGGGAGTGGAGCAGACACCACGAAACATGCGACAGACGATGAGTGTTCGGAATG
TCACCAACGGAGGAATCGTTCATTCACAGTTCAACTTGGCACGGAATCGGTTTCTTCAAAGGTGGGCGTTATGCG
GACTGTACTAGTAATATTTATCAAACTTTTCGATTTTATTCAGACGTTCATGACGTAGGTGTAGCTGATATTTTT
TTCATAAACGTGTACTGATTTCAGCTTTAGATGTATTAATTGCGGAAATAAGTGGACCCGGATTTAATTTCCTCA
ACAGGAAAGAGCTCGAAGTATAATCTGTTGCCGTTCAAATCTTTTGTTTCTCGCTGGTGATTGTCGAAGAGACGA
AGCGAAGTATTCAGAGTAAATCTCCTGTGGGGTCCCTTTGATTCTACCGCAATCTATTTTTGTTGAAACTCTTCA
AAGGTCATATTTTTTGGAAGCACGCACATTAGACGTTTACCCGATGCTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail