Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016220
Gene name
Locationscaffold_10:356755..357208
Strand+
Gene length (bp)453
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 2.8E-18 36 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 112 2.0E-23
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 8 112 6.0E-19
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 1 112 5.0E-16
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 34 112 6.0E-16
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 110 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 112 2.0E-23
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 8 112 6.0E-19
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 1 112 5.0E-16
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 34 112 6.0E-16
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 110 2.0E-15
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 1 112 2.0E-13
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 34 112 7.0E-13
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 16 111 3.0E-09
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 36 110 1.0E-07
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 28 111 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016220
MYSKLALFVASAFALGAVAAPGGEPAPSTGGQNSQCDVGKIDCCESTQDVKSSAVQNLAGLLGIDLGGITGIVGV
NCGILGGSSCSAQPVCCTGNSFHGLIVVGCSPINVSL*
Coding >AgabiH97|016220
ATGTACTCTAAACTCGCTCTCTTCGTCGCTTCCGCTTTCGCTCTCGGTGCCGTCGCTGCTCCCGGTGGTGAACCA
GCTCCCTCTACTGGGGGTCAAAATTCTCAATGCGATGTTGGAAAAATCGACTGCTGTGAATCCACTCAAGATGTC
AAGTCCTCAGCCGTTCAGAATCTCGCTGGCTTGCTCGGTATTGACCTTGGAGGTATTACTGGTATAGTCGGTGTC
AACTGTGGCATTCTCGGCGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCACCGGCAACAGTTTCCATGGCCTC
ATTGTCGTTGGCTGCTCCCCCATCAACGTCAGCCTCTAA
Transcript >AgabiH97|016220
ATGTACTCTAAACTCGCTCTCTTCGTCGCTTCCGCTTTCGCTCTCGGTGCCGTCGCTGCTCCCGGTGGTGAACCA
GCTCCCTCTACTGGGGGTCAAAATTCTCAATGCGATGTTGGAAAAATCGACTGCTGTGAATCCACTCAAGATGTC
AAGTCCTCAGCCGTTCAGAATCTCGCTGGCTTGCTCGGTATTGACCTTGGAGGTATTACTGGTATAGTCGGTGTC
AACTGTGGCATTCTCGGCGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCACCGGCAACAGTTTCCATGGCCTC
ATTGTCGTTGGCTGCTCCCCCATCAACGTCAGCCTCTAA
Gene >AgabiH97|016220
ATGTACTCTAAACTCGCTCTCTTCGTCGCTTCCGCTTTCGCTCTCGGTGCCGTCGCTGCTCCCGGTGGTGAACCA
GCTCCCTCTACTGGGGGTCAAAATTCTCAATGCGATGTTGGAAAAATCGACTGCTGTTAGTCATTTATTGCATCT
CATCAACTACTAGAAAATCTGACAATAGTTGCTTTTTGAAGGTGAATCCACTCAAGATGTCAAGTCCTCAGCCGT
TCAGAATCTCGCTGGCTTGCTCGGTATTGACCTTGGAGGTATTACTGGTATAGTCGGTGTCAACTGTGGCATTCT
CGGCGGCAGCAGCTGTTCCGCTCAACCCGTTTGCTGCACCGGCAACAGTTTCCGTAAGTTTTTTGGTAGTGCACG
ATTGAATATACTAATATATTTATATTATCAGATGGCCTCATTGTCGTTGGCTGCTCCCCCATCAACGTCAGCCTC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail