Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016200
Gene name
Locationscaffold_10:350480..352205
Strand-
Gene length (bp)1725
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 4.3E-55 119 372
PF00734 CBM_1 Fungal cellulose binding domain 5.0E-12 27 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 23 407 6.0E-176
sp|Q04469|GUN1_CRYFL Endoglucanase 1 OS=Cryptococcus flavus GN=CMC1 PE=2 SV=1 88 408 9.0E-80
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 9 401 4.0E-49
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 15 401 8.0E-49
sp|Q5BDU5|EGLA_EMENI Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglA PE=1 SV=1 84 391 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 23 407 6.0E-176
sp|Q04469|GUN1_CRYFL Endoglucanase 1 OS=Cryptococcus flavus GN=CMC1 PE=2 SV=1 88 408 9.0E-80
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 9 401 4.0E-49
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 15 401 8.0E-49
sp|Q5BDU5|EGLA_EMENI Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglA PE=1 SV=1 84 391 2.0E-38
sp|Q96WQ8|EGLB_ASPKW Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=eglB PE=3 SV=1 134 389 2.0E-34
sp|P23044|GUN_ROBSP Endoglucanase 1 OS=Robillarda sp. (strain Y-20) GN=eg 1 PE=1 SV=2 120 379 3.0E-34
sp|P58599|GUN_RALSO Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) GN=egl PE=3 SV=1 80 391 2.0E-33
sp|Q1HFS8|EGLB_EMENI Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglB PE=1 SV=1 79 391 3.0E-33
sp|A1DME8|EGLB_NEOFI Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglB PE=3 SV=1 136 389 9.0E-33
sp|P17974|GUN_RALSL Endoglucanase OS=Ralstonia solanacearum GN=egl PE=1 SV=2 83 391 1.0E-32
sp|Q2UPQ4|EGLB_ASPOR Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglB PE=3 SV=1 134 391 8.0E-32
sp|B8MW97|EGLB_ASPFN probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglB PE=3 SV=1 134 391 8.0E-32
sp|A2QPC3|EGLB_ASPNC Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglB PE=3 SV=1 136 389 7.0E-31
sp|O74706|EGLB_ASPNG Endo-beta-1,4-glucanase B OS=Aspergillus niger GN=eglB PE=1 SV=1 136 389 7.0E-31
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 7 93 2.0E-12
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 13 69 3.0E-10
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 20 59 3.0E-10
sp|Q12647|GUNB_NEOPA Endoglucanase B OS=Neocallimastix patriciarum GN=CELB PE=2 SV=1 127 302 4.0E-10
sp|P10477|CELE_CLOTH Cellulase/esterase CelE OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celE PE=1 SV=2 128 302 6.0E-10
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 10 60 6.0E-10
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 10 60 6.0E-10
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 20 76 9.0E-10
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 10 60 9.0E-10
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 20 76 3.0E-09
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 9 74 3.0E-09
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 6 116 4.0E-09
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 26 104 6.0E-09
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 26 104 6.0E-09
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 26 71 1.0E-08
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 24 92 2.0E-08
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 10 60 5.0E-08
sp|P28623|GUND_CLOC7 Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) GN=engD PE=1 SV=2 128 302 6.0E-08
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 25 67 6.0E-08
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 20 60 9.0E-08
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 19 59 9.0E-08
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 9 64 3.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 24 58 1.0E-06
sp|P23340|GUNC_CLOSF Endoglucanase C307 OS=Clostridium sp. (strain F1) GN=celC307 PE=1 SV=1 136 269 2.0E-06
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 12 60 2.0E-06
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 19 60 2.0E-06
sp|P0C2S3|GUNC_CLOTM Endoglucanase C OS=Clostridium thermocellum GN=celC PE=1 SV=1 136 269 2.0E-06
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 13 322 2.0E-06
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 13 322 2.0E-06
sp|A3DJ77|GUNC_CLOTH Endoglucanase C OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celC PE=3 SV=1 136 269 2.0E-06
sp|P28621|GUNB_CLOC7 Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) GN=engB PE=3 SV=1 136 302 3.0E-06
sp|P16218|GUNH_CLOTH Endoglucanase H OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celH PE=1 SV=1 119 275 5.0E-06
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 6 77 5.0E-06
sp|P17901|GUNA_CLOCE Endoglucanase A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=celCCA PE=1 SV=1 117 302 6.0E-06
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 6 86 7.0E-06
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 24 60 7.0E-06
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 24 58 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016200
MMSRKLLQISGFVLTSALAVRGQAAVWQQCGGTGWTGDTTCVSGSVCTPLNDFYSQCIPGEAPTSTVTSPAPTTT
TRPPVATGNGKLKFTGVNIAGFDFGCNGDGSCTASAAWPPLTKYYGHDGEGQMQHFVNDDGFNTFRLPVGWQFLT
GDVEGGPIVAANLAKYDDLVQACLNTGAFCIIDIHNYARWDRGIIGQGGPTNDEFAALWSAIASKYASEERIMFG
VMNEPHDVPDINAWAQSVQEVVTAIREAGATTQLILLPGNNWTSAETFVSNGSAAALQKVTNPNGSTDNLIFDVH
KYLDSDNSGTHPECTTNNIDRAWAPLADWLRENKRQAINTETGGGNTDSCVQFMCQQVAYQAANSDVYLGFVGWG
AGNFLTNYVLSETPTNNGNGWTDSLLVEKCLAPTSGAQNGLF*
Coding >AgabiH97|016200
ATGATGTCGAGGAAACTTTTGCAAATTTCTGGTTTTGTTTTGACCTCAGCGTTGGCCGTACGTGGTCAGGCTGCA
GTTTGGCAACAATGTGGTGGAACTGGTTGGACAGGCGATACGACTTGTGTTTCTGGTTCAGTCTGCACTCCTCTT
AATGACTTTTATTCCCAATGTATCCCAGGCGAAGCTCCTACGTCCACTGTAACATCACCGGCACCCACCACTACC
ACTAGGCCGCCCGTAGCCACCGGTAACGGTAAACTCAAGTTTACCGGTGTCAATATCGCTGGATTCGACTTCGGA
TGTAATGGCGATGGTTCATGCACAGCTAGTGCCGCTTGGCCCCCTTTGACTAAATACTATGGTCATGATGGCGAA
GGACAAATGCAACACTTCGTCAATGATGATGGGTTTAATACATTCCGTTTACCCGTCGGTTGGCAATTCTTGACC
GGTGACGTCGAGGGTGGACCAATTGTTGCTGCTAACTTGGCTAAGTATGATGACCTTGTGCAGGCTTGTCTGAAT
ACAGGTGCATTTTGTATCATTGATATTCATAATTACGCGAGGTGGGATAGAGGCATAATCGGACAAGGTGGACCT
ACCAATGATGAATTTGCTGCCTTGTGGTCAGCGATCGCCAGCAAATATGCATCAGAAGAAAGAATCATGTTTGGA
GTTATGAATGAACCGCACGATGTTCCCGATATCAATGCTTGGGCTCAATCTGTTCAAGAGGTTGTAACTGCCATC
CGCGAAGCCGGTGCAACGACCCAGCTTATCCTCCTTCCTGGCAATAACTGGACATCAGCAGAAACCTTTGTCTCT
AATGGTTCTGCAGCCGCATTACAAAAAGTGACGAACCCCAACGGATCTACGGACAATTTGATTTTCGATGTTCAC
AAATATCTCGACAGTGATAATTCCGGCACTCATCCTGAATGTACGACGAACAATATTGACCGCGCATGGGCACCT
CTTGCCGACTGGTTACGCGAAAATAAACGTCAAGCTATCAATACCGAGACCGGTGGTGGAAATACCGATTCATGT
GTACAATTCATGTGTCAACAGGTTGCTTATCAGGCCGCCAACTCCGATGTCTACTTGGGCTTCGTTGGCTGGGGT
GCAGGCAATTTCCTCACTAACTACGTTCTTAGCGAGACCCCAACCAACAACGGCAATGGTTGGACAGACAGTTTA
CTCGTTGAGAAATGTTTAGCGCCCACGTCTGGTGCTCAAAATGGTTTATTCTGA
Transcript >AgabiH97|016200
ATGATGTCGAGGAAACTTTTGCAAATTTCTGGTTTTGTTTTGACCTCAGCGTTGGCCGTACGTGGTCAGGCTGCA
GTTTGGCAACAATGTGGTGGAACTGGTTGGACAGGCGATACGACTTGTGTTTCTGGTTCAGTCTGCACTCCTCTT
AATGACTTTTATTCCCAATGTATCCCAGGCGAAGCTCCTACGTCCACTGTAACATCACCGGCACCCACCACTACC
ACTAGGCCGCCCGTAGCCACCGGTAACGGTAAACTCAAGTTTACCGGTGTCAATATCGCTGGATTCGACTTCGGA
TGTAATGGCGATGGTTCATGCACAGCTAGTGCCGCTTGGCCCCCTTTGACTAAATACTATGGTCATGATGGCGAA
GGACAAATGCAACACTTCGTCAATGATGATGGGTTTAATACATTCCGTTTACCCGTCGGTTGGCAATTCTTGACC
GGTGACGTCGAGGGTGGACCAATTGTTGCTGCTAACTTGGCTAAGTATGATGACCTTGTGCAGGCTTGTCTGAAT
ACAGGTGCATTTTGTATCATTGATATTCATAATTACGCGAGGTGGGATAGAGGCATAATCGGACAAGGTGGACCT
ACCAATGATGAATTTGCTGCCTTGTGGTCAGCGATCGCCAGCAAATATGCATCAGAAGAAAGAATCATGTTTGGA
GTTATGAATGAACCGCACGATGTTCCCGATATCAATGCTTGGGCTCAATCTGTTCAAGAGGTTGTAACTGCCATC
CGCGAAGCCGGTGCAACGACCCAGCTTATCCTCCTTCCTGGCAATAACTGGACATCAGCAGAAACCTTTGTCTCT
AATGGTTCTGCAGCCGCATTACAAAAAGTGACGAACCCCAACGGATCTACGGACAATTTGATTTTCGATGTTCAC
AAATATCTCGACAGTGATAATTCCGGCACTCATCCTGAATGTACGACGAACAATATTGACCGCGCATGGGCACCT
CTTGCCGACTGGTTACGCGAAAATAAACGTCAAGCTATCAATACCGAGACCGGTGGTGGAAATACCGATTCATGT
GTACAATTCATGTGTCAACAGGTTGCTTATCAGGCCGCCAACTCCGATGTCTACTTGGGCTTCGTTGGCTGGGGT
GCAGGCAATTTCCTCACTAACTACGTTCTTAGCGAGACCCCAACCAACAACGGCAATGGTTGGACAGACAGTTTA
CTCGTTGAGAAATGTTTAGCGCCCACGTCTGGTGCTCAAAATGGTTTATTCTGA
Gene >AgabiH97|016200
ATGATGTCGAGGAAACTTTTGCAAATTTCTGGTTTTGTTTTGACCTCAGCGTTGGCCGTACGTGGTCAGGCTGCA
GTTTGGCAACAATGTATGTGTGTTTCGAGAAACTTGGTTTGGCAAGAGGCTGATGCTCGGTTTTAACTAGGTGGT
GGAACTGTGAGTACCCAGACATTATTCCCCAGAAGAAAAACATTCACACATGTATCTTTTCTAGGGTTGGACAGG
CGATACGACTTGTGTTTCTGGTTCAGTCTGCACTCCTCTTAATGACTGTACGCCCCTTCATTTTATCTGCCAATC
ATTTTGGATTTGCTTACCACCTTGTTTCATCAGTTTATTCCCAATGTATCCCAGGCGAAGCTCCTACGTCCACTG
TAACATCACCGGCACCCACCACTACCACTAGGCCGCCCGTAGCCACCGGTAACGGTAAACTCAAGTTTACCGGTG
TCAATATCGCTGGATTCGACTTCGGATGTAATGGCGATGGTTCATGCACAGCTAGTGCCGCTTGGCCCCCTTTGA
CTAAATACTATGGTCATGATGGCGAAGGACAAATGCAACACTTCGTCAATGATGATGGGTTTAATACATTCCGTT
TACCCGTCGGTTGGCAATTCTTGACCGGTGACGTCGAGGGTGGACCAATTGTTGCTGCTAACTTGGCTAAGTATG
ATGACCTTGTGCAGGCTTGTCTGAATACAGGTGCATTTTGTATCATTGATATTCATAATTACGCGAGGTGGGATA
GAGGCGTAAGTTCGGATTTCTCATAGCTGCCTTTACTATTATGTTTACTGATTATCAAACGCGTAACAGATAATC
GGACAAGGTGGACCTACCAATGATGAATTTGCTGCCTTGTGGTCAGCGATCGCCAGCAAATATGCATCAGAAGAA
AGAATCATGTTTGGAGTGTACGTAAATTGCCCCCCATACAATTTAACCAACGCATCTAAACTTCTCTTGTGACAG
TATGAATGAACCGCACGATGTTCCCGATATCAATGCTTGGGCTCAATCTGTTCAAGAGGTTGTAACTGCCATCCG
CGAAGCCGGGTAAGTATCTCTCCATTAACTGTTACAAGGTCGAAATTCATATTGAAAAATGGTGATAGTGCAACG
ACCCAGCTTATCCTCCTTCCTGGCAATAACTGGACATCAGCAGAAACCTTTGTCTCTAATGGTTCTGCAGCCGCA
TTACAAAAAGTGACGAACCCCAACGGATCTACGGACAATTTGATTTTCGATGTTCACAAATATCTCGACAGTGAT
AATTCCGGCACTCATCCGTAAGTCGTACACTCAAGATGCATTTATGAGGGCTTTGTTCATTAATAATTTTTTCCT
AGTGAATGTACGACGAACAATATTGACCGCGCATGGGCACCTCTTGCCGACTGGTTACGCGAAAATAAACGTCAA
GCTATCAATACCGAGACCGGTGGTGGAAATACCGATTCATGTGTACAATTCATGTGTCAACAGGTTGCTTATCAG
GCCGCCAACTCCGATGGTAAGTCTTGTTCCCTCAAATGTTGTATATTCTACTAATACAACTCGATTACAGTCTAC
TTGGGCTTCGTTGGCTGGGGTGCAGGCAATTTCCTCACTAACTACGTTCTTAGCGAGACCCCAACCAACAACGGC
AATGGTTGGACAGACAGTTTACTCGTTGAGAAATGTTTAGCGCCCACGTCTGGTGCTCAAAATGGTTTATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail