Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016090
Gene name
Locationscaffold_10:326010..326808
Strand+
Gene length (bp)798
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 1.4E-11 33 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53368|8ODP_MOUSE 7,8-dihydro-8-oxoguanine triphosphatase OS=Mus musculus GN=Nudt1 PE=1 SV=1 34 179 1.0E-31
sp|P53369|8ODP_RAT 7,8-dihydro-8-oxoguanine triphosphatase OS=Rattus norvegicus GN=Nudt1 PE=1 SV=1 34 179 2.0E-31
sp|P36639|8ODP_HUMAN 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens GN=NUDT1 PE=1 SV=3 32 179 7.0E-30
sp|P59659|MUTX_STRR6 8-oxo-dGTP diphosphatase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mutX PE=3 SV=1 35 168 6.0E-08
sp|P41354|MUTX_STRPN 8-oxo-dGTP diphosphatase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mutX PE=1 SV=2 35 168 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53368|8ODP_MOUSE 7,8-dihydro-8-oxoguanine triphosphatase OS=Mus musculus GN=Nudt1 PE=1 SV=1 34 179 1.0E-31
sp|P53369|8ODP_RAT 7,8-dihydro-8-oxoguanine triphosphatase OS=Rattus norvegicus GN=Nudt1 PE=1 SV=1 34 179 2.0E-31
sp|P36639|8ODP_HUMAN 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens GN=NUDT1 PE=1 SV=3 32 179 7.0E-30
sp|P59659|MUTX_STRR6 8-oxo-dGTP diphosphatase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mutX PE=3 SV=1 35 168 6.0E-08
sp|P41354|MUTX_STRPN 8-oxo-dGTP diphosphatase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mutX PE=1 SV=2 35 168 2.0E-07
sp|P77788|NUDG_ECOLI CTP pyrophosphohydrolase OS=Escherichia coli (strain K12) GN=nudG PE=1 SV=1 35 140 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016090
MSSQIPPGISQGLDYFASGNDNKEWLPLLPIKHYTVAHILQDDKVLLGYKKRGFGQGMYNGFGGKVEPNETPLQA
AVRELEEEAGIKAPLQHIGVLIFIVAGAEKAFHIDIYYAQEFEGTVTETEEMRPEWFSLSPSDGPGELPPIPWDK
MWDTDRYWFPLLRDKRPFVGRADFETNESGAFISRRWWYGTIQ*
Coding >AgabiH97|016090
ATGTCGAGTCAAATACCACCCGGGATAAGTCAAGGACTGGATTACTTTGCCAGTGGGAACGATAACAAGGAATGG
CTTCCTTTACTTCCCATCAAGCATTATACCGTCGCACATATTTTGCAAGATGATAAGGTTCTTCTCGGATACAAA
AAGCGTGGATTCGGTCAAGGAATGTATAATGGTTTTGGCGGTAAAGTTGAACCGAACGAAACGCCATTGCAAGCA
GCCGTACGAGAACTAGAGGAAGAAGCTGGAATAAAAGCACCGCTACAGCACATAGGTGTTTTGATCTTCATCGTG
GCTGGTGCCGAGAAAGCCTTTCATATTGATATCTACTATGCCCAGGAATTTGAGGGCACAGTAACGGAGACTGAA
GAGATGAGGCCTGAATGGTTTTCTTTGTCTCCATCTGATGGTCCGGGAGAATTACCACCCATTCCATGGGACAAA
ATGTGGGATACCGATCGCTACTGGTTTCCACTCTTAAGGGATAAACGACCCTTCGTTGGGAGAGCGGATTTTGAA
ACAAATGAGAGTGGAGCTTTCATATCAAGGCGGTGGTGGTATGGTACAATACAGTGA
Transcript >AgabiH97|016090
ATGTCGAGTCAAATACCACCCGGGATAAGTCAAGGACTGGATTACTTTGCCAGTGGGAACGATAACAAGGAATGG
CTTCCTTTACTTCCCATCAAGCATTATACCGTCGCACATATTTTGCAAGATGATAAGGTTCTTCTCGGATACAAA
AAGCGTGGATTCGGTCAAGGAATGTATAATGGTTTTGGCGGTAAAGTTGAACCGAACGAAACGCCATTGCAAGCA
GCCGTACGAGAACTAGAGGAAGAAGCTGGAATAAAAGCACCGCTACAGCACATAGGTGTTTTGATCTTCATCGTG
GCTGGTGCCGAGAAAGCCTTTCATATTGATATCTACTATGCCCAGGAATTTGAGGGCACAGTAACGGAGACTGAA
GAGATGAGGCCTGAATGGTTTTCTTTGTCTCCATCTGATGGTCCGGGAGAATTACCACCCATTCCATGGGACAAA
ATGTGGGATACCGATCGCTACTGGTTTCCACTCTTAAGGGATAAACGACCCTTCGTTGGGAGAGCGGATTTTGAA
ACAAATGAGAGTGGAGCTTTCATATCAAGGCGGTGGTGGTATGGTACAATACAGTGA
Gene >AgabiH97|016090
ATGTCGAGTCAAATACCACCCGGGATAAGTCAAGGACTGGATTACTTTGCCAGTGGGAACGATAACAAGGAATGG
CTTCCTTTACTTCCCATCAAGCATTATACCGTCGCACATATTTTGCAAGATGATAAGGTAATTTAAGGTCTTTAA
GTCATCGATGGGCTGAACCGCATACTCCCTCAGGTTCTTCTCGGATACAAAAAGCGTGGATTCGGTCAAGGAATG
TACGCATACGTGTTCCAGAATGATCTTCAAGAAAGAATTATTGACTGCTCATATAGGTATAATGGTTTTGGCGGT
AAAGTTGAACCGAACGAAACGCCATTGCAAGCAGCCGTACGAGAACTAGAGGTAGTGTCAACTTCTATATAAGAC
GGCTGAACTCAACTCATTCTGTTGCGCAGGAAGAAGCTGGAATAAAAGCACCGCTACAGCACATAGGTGTTTTGA
TCTTCATCGTGGCTGGTGCCGAGAAAGCCTTTCATATTGATATCTACTATGCCCAGGAATTTGAGGGCACAGTAA
CGGAGTATGAGTTTCTCATTCCATTAATAATTTATTTCCACGTGCTCATACAGTAACAGGACTGAAGAGATGAGG
CCTGAATGGTTTTCTTTGTCTCCATCTGATGGTCCGGGAGAATTACCACCCATTCCATGGGACAAAATGTGGGAT
ACCGATCGCTACTGGTTTCCACTCTTAAGGGATAAACGACCCTTCGTTGGGAGAGCGGATTTTGAAACAAATGAG
AGTGGAGCTTTCATATCAAGGCGGTGGTGGTATGGTACAATACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail