Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|016050
Gene name
Locationscaffold_10:318270..319880
Strand+
Gene length (bp)1610
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 215 237 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 121.97 72.56 171.38
Initials Initials knots 107.44 64.08 150.81
Pileal_Stipeal_center Stage I stipe center 160.18 93.98 226.38
Pileal_Stipeal_shell Stage I stipe shell 98.70 58.84 138.56
DIF_stipe_center Stage II stipe center 174.87 102.00 247.75
DIF_stipe_shell Stage II stipe shell 189.45 109.69 269.21
DIF_stipe_skin Stage II stipe skin 148.24 87.33 209.14
DIF_cap_skin Stage II cap skin 116.97 69.71 164.22
DIF_cap_tissue Stage II cap tissue 143.46 84.52 202.40
DIF_gill_tissue Stage II gill tissue 126.75 74.78 178.73
YFB_stipe_center Young fruiting body stipe center 186.68 107.74 265.62
YFB_stipe_shell Young fruiting body stipe shell 212.58 121.16 303.99
YFB_stipe_skin Young fruiting body stipe skin 152.73 89.83 215.62
YFB_cap_skin Young fruiting body cap skin 125.32 74.50 176.14
YFB_cap_tissue Young fruiting body cap tissue 211.70 121.31 302.09
YFB_gill_tissue Young fruiting body gill tissue 112.48 67.10 157.86
YFB_veil Young fruiting body veil 115.13 68.70 161.55

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.944146 no
Casing YFB_stipe_center 0.144159 no
Casing YFB_stipe_shell 0.051932 no
Casing YFB_stipe_skin 0.539074 no
Casing YFB_cap_skin 0.961870 no
Casing YFB_cap_tissue 0.050706 no
Casing YFB_gill_tissue 0.869333 no
Casing YFB_veil 0.911933 no
Casing Initials 0.773287 no
Casing Pileal_Stipeal_center 0.420211 no
Casing Pileal_Stipeal_shell 0.568328 no
Casing DIF_stipe_center 0.238319 no
Casing DIF_stipe_shell 0.125429 no
Casing DIF_stipe_skin 0.616287 no
Casing DIF_cap_skin 0.937209 no
Casing DIF_cap_tissue 0.694670 no
DIF_gill_tissue YFB_stipe_center 0.203999 no
DIF_gill_tissue YFB_stipe_shell 0.071041 no
DIF_gill_tissue YFB_stipe_skin 0.638541 no
DIF_gill_tissue YFB_cap_skin 0.984314 no
DIF_gill_tissue YFB_cap_tissue 0.069952 no
DIF_gill_tissue YFB_gill_tissue 0.789486 no
DIF_gill_tissue YFB_veil 0.840342 no
YFB_stipe_center YFB_stipe_shell 0.775524 no
YFB_stipe_center YFB_stipe_skin 0.606067 no
YFB_stipe_center YFB_cap_skin 0.182182 no
YFB_stipe_center YFB_cap_tissue 0.789222 no
YFB_stipe_center YFB_gill_tissue 0.071782 no
YFB_stipe_center YFB_veil 0.083843 no
YFB_stipe_shell YFB_stipe_skin 0.318332 no
YFB_stipe_shell YFB_cap_skin 0.061086 no
YFB_stipe_shell YFB_cap_tissue 0.993704 no
YFB_stipe_shell YFB_gill_tissue 0.015242 yes
YFB_stipe_shell YFB_veil 0.022631 yes
YFB_stipe_skin YFB_cap_skin 0.603469 no
YFB_stipe_skin YFB_cap_tissue 0.327110 no
YFB_stipe_skin YFB_gill_tissue 0.348230 no
YFB_stipe_skin YFB_veil 0.397993 no
YFB_cap_skin YFB_cap_tissue 0.059712 no
YFB_cap_skin YFB_gill_tissue 0.813241 no
YFB_cap_skin YFB_veil 0.861967 no
YFB_cap_tissue YFB_gill_tissue 0.019987 yes
YFB_cap_tissue YFB_veil 0.026710 yes
YFB_gill_tissue YFB_veil 0.966912 no
Initials DIF_gill_tissue 0.685681 no
Initials YFB_stipe_center 0.042041 yes
Initials YFB_stipe_shell 0.011041 yes
Initials YFB_stipe_skin 0.256658 no
Initials YFB_cap_skin 0.707297 no
Initials YFB_cap_tissue 0.011041 yes
Initials YFB_gill_tissue 0.929951 no
Initials YFB_veil 0.890791 no
Initials Pileal_Stipeal_center 0.177565 no
Initials Pileal_Stipeal_shell 0.859799 no
Initials DIF_stipe_center 0.082633 no
Initials DIF_stipe_shell 0.037140 yes
Initials DIF_stipe_skin 0.310391 no
Initials DIF_cap_skin 0.858297 no
Initials DIF_cap_tissue 0.381485 no
Pileal_Stipeal_center DIF_gill_tissue 0.524695 no
Pileal_Stipeal_center YFB_stipe_center 0.722335 no
Pileal_Stipeal_center YFB_stipe_shell 0.422809 no
Pileal_Stipeal_center YFB_stipe_skin 0.930322 no
Pileal_Stipeal_center YFB_cap_skin 0.487712 no
Pileal_Stipeal_center YFB_cap_tissue 0.431258 no
Pileal_Stipeal_center YFB_gill_tissue 0.252728 no
Pileal_Stipeal_center YFB_veil 0.295714 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.080883 no
Pileal_Stipeal_center DIF_stipe_center 0.859779 no
Pileal_Stipeal_center DIF_stipe_shell 0.685225 no
Pileal_Stipeal_center DIF_stipe_skin 0.880313 no
Pileal_Stipeal_center DIF_cap_skin 0.327207 no
Pileal_Stipeal_center DIF_cap_tissue 0.814779 no
Pileal_Stipeal_shell DIF_gill_tissue 0.483508 no
Pileal_Stipeal_shell YFB_stipe_center 0.014374 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.003365 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.128073 no
Pileal_Stipeal_shell YFB_cap_skin 0.498965 no
Pileal_Stipeal_shell YFB_cap_tissue 0.002951 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.761216 no
Pileal_Stipeal_shell YFB_veil 0.707811 no
Pileal_Stipeal_shell DIF_stipe_center 0.032266 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.015242 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.165026 no
Pileal_Stipeal_shell DIF_cap_skin 0.665887 no
Pileal_Stipeal_shell DIF_cap_tissue 0.218082 no
DIF_stipe_center DIF_gill_tissue 0.320910 no
DIF_stipe_center YFB_stipe_center 0.901835 no
DIF_stipe_center YFB_stipe_shell 0.617829 no
DIF_stipe_center YFB_stipe_skin 0.752734 no
DIF_stipe_center YFB_cap_skin 0.281547 no
DIF_stipe_center YFB_cap_tissue 0.632819 no
DIF_stipe_center YFB_gill_tissue 0.121114 no
DIF_stipe_center YFB_veil 0.141536 no
DIF_stipe_center DIF_stipe_shell 0.873249 no
DIF_stipe_center DIF_stipe_skin 0.685194 no
DIF_stipe_center DIF_cap_skin 0.168544 no
DIF_stipe_center DIF_cap_tissue 0.604397 no
DIF_stipe_shell DIF_gill_tissue 0.183309 no
DIF_stipe_shell YFB_stipe_center 0.979259 no
DIF_stipe_shell YFB_stipe_shell 0.807785 no
DIF_stipe_shell YFB_stipe_skin 0.564806 no
DIF_stipe_shell YFB_cap_skin 0.159322 no
DIF_stipe_shell YFB_cap_tissue 0.819195 no
DIF_stipe_shell YFB_gill_tissue 0.062038 no
DIF_stipe_shell YFB_veil 0.074840 no
DIF_stipe_shell DIF_stipe_skin 0.496358 no
DIF_stipe_shell DIF_cap_skin 0.087755 no
DIF_stipe_shell DIF_cap_tissue 0.415145 no
DIF_stipe_skin DIF_gill_tissue 0.712265 no
DIF_stipe_skin YFB_stipe_center 0.531625 no
DIF_stipe_skin YFB_stipe_shell 0.258299 no
DIF_stipe_skin YFB_stipe_skin 0.957899 no
DIF_stipe_skin YFB_cap_skin 0.680313 no
DIF_stipe_skin YFB_cap_tissue 0.264618 no
DIF_stipe_skin YFB_gill_tissue 0.411711 no
DIF_stipe_skin YFB_veil 0.467679 no
DIF_stipe_skin DIF_cap_skin 0.504198 no
DIF_stipe_skin DIF_cap_tissue 0.954808 no
DIF_cap_skin DIF_gill_tissue 0.872362 no
DIF_cap_skin YFB_stipe_center 0.098108 no
DIF_cap_skin YFB_stipe_shell 0.028675 yes
DIF_cap_skin YFB_stipe_skin 0.437934 no
DIF_cap_skin YFB_cap_skin 0.891680 no
DIF_cap_skin YFB_cap_tissue 0.026215 yes
DIF_cap_skin YFB_gill_tissue 0.942152 no
DIF_cap_skin YFB_veil 0.977236 no
DIF_cap_skin DIF_cap_tissue 0.592238 no
DIF_cap_tissue DIF_gill_tissue 0.789696 no
DIF_cap_tissue YFB_stipe_center 0.454843 no
DIF_cap_tissue YFB_stipe_shell 0.217311 no
DIF_cap_tissue YFB_stipe_skin 0.906826 no
DIF_cap_tissue YFB_cap_skin 0.757854 no
DIF_cap_tissue YFB_cap_tissue 0.217311 no
DIF_cap_tissue YFB_gill_tissue 0.494252 no
DIF_cap_tissue YFB_veil 0.549486 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|016050
MLLMLSPAVMVLLTFFIEGARSQLPDQEFTPTANPAPLPSSTQVLFLQNFNFPLTTCTVHNVSWSYNGLDTRLDI
AATNVNVPQGPPPAPFPSRPVVTFTDDGVVRAQRPRAPDVINNFIARDLEASALHIPWKVSVPSGWYSIVVANGV
ERLDQTDPFFVQDGTDTSCLLGGHTSSSTSSPSPSSSNPASGAPQETVSPPAPVASTSKDNHVGIIIGVVAGVVV
ALIVILIAFLCLRRRKHAQERPASVLPGAGLRRGWGGLGSFSSIHSVKPAPTSRDLAVTTREHTRHTEERAPRSS
VSTPFSLEEKVSTSPVFSSRNPFDDTEGGITLATLPSNGRRSSSARSSLQQYPPRHNPSISAIVNSYDLETSTRS
TDLSSSRHNSLSTAEMMPSYSSSSSSSASPTERNKAEHGSSGSQSGVRKTPRKPVPAYDPAVHTSSTPSPLVENT
SPIALTPGTPIVSSISGQGHYAKKSQYAASNPEGIDRLPRKSSFGPGGIEGKPIHYLIPDMPLPKAN*
Coding >AgabiH97|016050
ATGCTGCTCATGTTGTCGCCTGCTGTTATGGTGCTCCTAACCTTCTTCATTGAAGGTGCACGCAGTCAGCTTCCA
GATCAAGAATTTACACCTACTGCGAACCCTGCACCTCTACCGTCGTCAACACAGGTCCTCTTCTTGCAAAACTTT
AATTTTCCACTGACCACCTGCACGGTTCACAACGTCTCCTGGTCGTACAATGGACTAGATACACGGCTTGATATT
GCCGCAACCAACGTCAATGTCCCACAGGGGCCACCTCCTGCACCGTTCCCCTCGCGGCCTGTAGTTACCTTTACC
GATGATGGCGTCGTGCGTGCACAGCGCCCGCGCGCTCCTGATGTCATCAACAACTTTATCGCTCGAGACTTGGAA
GCCTCAGCCTTACATATACCTTGGAAAGTCAGTGTGCCATCTGGCTGGTATAGTATTGTCGTGGCAAACGGAGTT
GAACGATTGGATCAGACTGATCCCTTTTTTGTGCAAGACGGCACGGATACCTCATGCCTCCTGGGCGGTCATACG
AGTTCTTCTACCTCAAGTCCAAGCCCATCGTCGTCAAACCCAGCTTCAGGAGCTCCCCAAGAAACTGTCAGCCCT
CCCGCTCCTGTTGCCTCCACCTCCAAAGACAATCATGTAGGCATCATTATTGGGGTTGTAGCAGGTGTTGTGGTT
GCCTTGATCGTCATACTCATCGCTTTCCTCTGCCTACGAAGAAGAAAACACGCCCAAGAGAGGCCTGCTAGCGTA
CTTCCAGGAGCAGGACTTCGTCGAGGCTGGGGTGGACTGGGTTCTTTCAGTTCAATTCATTCTGTCAAGCCAGCT
CCTACTTCTCGTGACTTGGCGGTCACCACACGTGAACACACTCGCCACACCGAGGAGAGAGCACCAAGAAGCAGC
GTTTCCACGCCTTTTTCTTTGGAGGAAAAGGTCTCCACTTCTCCCGTCTTTAGCTCAAGAAACCCATTTGATGAT
ACTGAGGGAGGTATCACCCTGGCGACTTTGCCGTCGAATGGCCGCAGATCTAGTTCTGCGAGATCGTCCCTTCAA
CAGTATCCACCCCGACATAATCCATCGATTAGTGCGATTGTAAATTCATACGACCTCGAAACAAGCACTCGTTCC
ACCGATTTGTCGTCCTCACGACATAACTCGCTATCGACTGCCGAGATGATGCCATCATACTCTTCTTCTTCTTCT
TCCAGTGCCTCGCCTACCGAACGGAACAAGGCCGAACATGGATCTTCAGGTTCGCAATCGGGTGTGAGGAAGACT
CCGCGCAAGCCAGTCCCTGCATACGACCCTGCCGTTCACACTTCAAGTACCCCGTCTCCATTGGTGGAAAATACT
TCTCCGATAGCCCTTACCCCAGGTACTCCAATTGTGTCTTCGATCTCGGGTCAGGGTCATTACGCCAAGAAGTCG
CAATATGCTGCGAGCAACCCGGAAGGTATTGATAGGCTACCTCGCAAGAGTAGCTTTGGTCCTGGCGGCATCGAA
GGGAAACCTATACATTATCTGATACCTGATATGCCCCTCCCAAAGGCGAATTGA
Transcript >AgabiH97|016050
ATGCTGCTCATGTTGTCGCCTGCTGTTATGGTGCTCCTAACCTTCTTCATTGAAGGTGCACGCAGTCAGCTTCCA
GATCAAGAATTTACACCTACTGCGAACCCTGCACCTCTACCGTCGTCAACACAGGTCCTCTTCTTGCAAAACTTT
AATTTTCCACTGACCACCTGCACGGTTCACAACGTCTCCTGGTCGTACAATGGACTAGATACACGGCTTGATATT
GCCGCAACCAACGTCAATGTCCCACAGGGGCCACCTCCTGCACCGTTCCCCTCGCGGCCTGTAGTTACCTTTACC
GATGATGGCGTCGTGCGTGCACAGCGCCCGCGCGCTCCTGATGTCATCAACAACTTTATCGCTCGAGACTTGGAA
GCCTCAGCCTTACATATACCTTGGAAAGTCAGTGTGCCATCTGGCTGGTATAGTATTGTCGTGGCAAACGGAGTT
GAACGATTGGATCAGACTGATCCCTTTTTTGTGCAAGACGGCACGGATACCTCATGCCTCCTGGGCGGTCATACG
AGTTCTTCTACCTCAAGTCCAAGCCCATCGTCGTCAAACCCAGCTTCAGGAGCTCCCCAAGAAACTGTCAGCCCT
CCCGCTCCTGTTGCCTCCACCTCCAAAGACAATCATGTAGGCATCATTATTGGGGTTGTAGCAGGTGTTGTGGTT
GCCTTGATCGTCATACTCATCGCTTTCCTCTGCCTACGAAGAAGAAAACACGCCCAAGAGAGGCCTGCTAGCGTA
CTTCCAGGAGCAGGACTTCGTCGAGGCTGGGGTGGACTGGGTTCTTTCAGTTCAATTCATTCTGTCAAGCCAGCT
CCTACTTCTCGTGACTTGGCGGTCACCACACGTGAACACACTCGCCACACCGAGGAGAGAGCACCAAGAAGCAGC
GTTTCCACGCCTTTTTCTTTGGAGGAAAAGGTCTCCACTTCTCCCGTCTTTAGCTCAAGAAACCCATTTGATGAT
ACTGAGGGAGGTATCACCCTGGCGACTTTGCCGTCGAATGGCCGCAGATCTAGTTCTGCGAGATCGTCCCTTCAA
CAGTATCCACCCCGACATAATCCATCGATTAGTGCGATTGTAAATTCATACGACCTCGAAACAAGCACTCGTTCC
ACCGATTTGTCGTCCTCACGACATAACTCGCTATCGACTGCCGAGATGATGCCATCATACTCTTCTTCTTCTTCT
TCCAGTGCCTCGCCTACCGAACGGAACAAGGCCGAACATGGATCTTCAGGTTCGCAATCGGGTGTGAGGAAGACT
CCGCGCAAGCCAGTCCCTGCATACGACCCTGCCGTTCACACTTCAAGTACCCCGTCTCCATTGGTGGAAAATACT
TCTCCGATAGCCCTTACCCCAGGTACTCCAATTGTGTCTTCGATCTCGGGTCAGGGTCATTACGCCAAGAAGTCG
CAATATGCTGCGAGCAACCCGGAAGGTATTGATAGGCTACCTCGCAAGAGTAGCTTTGGTCCTGGCGGCATCGAA
GGGAAACCTATACATTATCTGATACCTGATATGCCCCTCCCAAAGGCGAATTGA
Gene >AgabiH97|016050
ATGCTGCTCATGTTGTCGCCTGCTGTTATGGTGCTCCTAACCTTCTTCATTGAAGGTGCACGCAGTCAGCTTCCA
GATCAAGAATGTAAATTTTTTTTCATCATTTTCAATGCCGTCGTCGTCTTATGCCTATTTTCCTAGTTACACCTA
CTGCGAACCCTGCACCTCTACCGTCGTCAACACAGGTCCTCTTCTTGCAAAACTTTAATTTTCCACTGACCACCT
GCACGGTTCACAACGTCTCCTGGTCGTACAATGGACTAGATACACGGCTTGATATTGCCGCAACCAACGTCAATG
TCCCACAGGGGCCACCTCCTGCACCGTTCCCCTCGCGGCCTGTAGTTACCTTTACCGATGATGGCGTCGTGCGTG
CACAGCGCCCGCGCGCTCCTGATGTCATCAACAACTTTATCGCTCGAGACTTGGAAGCCTCAGCCTTACATATAC
CTTGGAAAGTCAGTGTGCCATCTGGCTGGTATAGTATTGTCGTGGCAAACGGAGTTGAACGATTGGATCAGACTG
ATCCCTTTTTTGTGCAAGACGGCACGGATACCTCATGCCTCCTGGGCGGTCATACGAGTTCTTCTACCTCAAGTC
CAAGCCCATCGTCGTCAAACCCAGCTTCAGGAGCTCCCCAAGAAACTGTCAGCCCTCCCGCTCCTGTTGCCTCCA
CCTCCAAAGACAATCATGTAGGCATCATTATTGGGGTTGTAGCAGGTGTTGTGGTTGCCTTGATCGTCATACTCA
TCGCTTTCCTCTGCCTACGAAGAAGAAAACACGCCCAAGAGAGGCCTGCTAGCGTACTTCCAGGAGCAGGACTTC
GTCGAGGCTGGGGTGGACTGGGTTCTTTCAGTTCAATTCATTCTGTCAAGCCAGCTCCTACTTCTCGTGACTTGG
CGGTCACCACACGTGAACACACTCGCCACACCGAGGAGAGAGCACCAAGAAGCAGCGTTTCCACGCCTTTTTCTT
TGGAGGAAAAGGTCTCCACTTCTCCCGTCTTTAGCTCAAGAAACCCATTTGATGATACTGAGGGAGGTATCACCC
TGGCGACTTTGCCGTCGAATGGCCGCAGATCTAGTTCTGCGAGATCGTCCCTTCAACAGTATCCACCCCGACATA
ATCCATCGATTAGTGCGATTGTAAATTCATACGACCTCGAAACAAGCACTCGTTCCACCGATTTGTCGTCCTCAC
GACATAACTCGCTATCGACTGCCGAGATGATGCCATCATACTCTTCTTCTTCTTCTTCCAGTGCCTCGCCTACCG
AACGGAACAAGGCCGAACATGGATCTTCAGGTTCGCAATCGGGTGTGAGGAAGACTCCGCGCAAGCCAGTCCCTG
CATACGACCCTGCCGTTCACACTTCAAGTACCCCGTCTCCATTGGTGGAAAATACTTCTCCGATAGCCCTTACCC
CAGGTACTCCAATTGTGTCTTCGATCTCGGGTCAGGGTCATTACGCCAAGAAGTCGCAATATGCTGCGAGCAACC
CGGAAGGTATTGATAGGCTACCTCGCAAGAGTAGCTTTGGTCCTGGCGGCATCGAAGGGAAACCTATACATTATC
TGATACCTGATATGCCCCTCCCAAAGGCGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail