Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015430
Gene name
Locationscaffold_10:147109..149750
Strand-
Gene length (bp)2641
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02128 Peptidase_M36 Fungalysin metallopeptidase (M36) 2.7E-141 226 583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NC58|MEP1_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 90 586 9.0E-104
sp|Q2U1G7|NPI_ASPOR Extracellular metalloproteinase NpI OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpI PE=2 SV=1 90 586 1.0E-103
sp|A1DBW0|MEP_NEOFI Extracellular metalloproteinase MEP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MEP PE=2 SV=1 164 596 3.0E-94
sp|A2Q7V4|MEP_ASPNC Extracellular metalloproteinase mep OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mep PE=3 SV=1 51 596 9.0E-94
sp|C5P7A7|MEP10_COCP7 Extracellular metalloproteinase 10 OS=Coccidioides posadasii (strain C735) GN=MEP10 PE=3 SV=1 105 596 2.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NC58|MEP1_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 90 586 9.0E-104
sp|Q2U1G7|NPI_ASPOR Extracellular metalloproteinase NpI OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpI PE=2 SV=1 90 586 1.0E-103
sp|A1DBW0|MEP_NEOFI Extracellular metalloproteinase MEP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MEP PE=2 SV=1 164 596 3.0E-94
sp|A2Q7V4|MEP_ASPNC Extracellular metalloproteinase mep OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mep PE=3 SV=1 51 596 9.0E-94
sp|C5P7A7|MEP10_COCP7 Extracellular metalloproteinase 10 OS=Coccidioides posadasii (strain C735) GN=MEP10 PE=3 SV=1 105 596 2.0E-93
sp|A4QWP8|MEP_MAGO7 Extracellular metalloproteinase MEP OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MEP PE=2 SV=1 102 596 2.0E-92
sp|B0Y9E2|MEP_ASPFC Extracellular metalloproteinase mep OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mep PE=3 SV=1 164 596 3.0E-92
sp|P46075|ELM_ASPFU Extracellular metalloproteinase mep OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mep PE=1 SV=3 164 596 3.0E-92
sp|Q8J0D5|MEP1_ARTOT Extracellular metalloproteinase 1 OS=Arthroderma otae GN=MEP1 PE=1 SV=1 164 596 3.0E-91
sp|C5FYJ8|MEP1_ARTOC Extracellular metalloproteinase 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP1 PE=3 SV=2 164 596 4.0E-91
sp|C4JR56|MEP9_UNCRE Extracellular metalloproteinase 9 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MEP9 PE=3 SV=1 101 596 9.0E-91
sp|Q6WIH4|MEP4_ARTOT Extracellular metalloproteinase 4 OS=Arthroderma otae GN=MEP4 PE=1 SV=1 116 596 1.0E-90
sp|C5FIK0|MEP4_ARTOC Extracellular metalloproteinase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP4 PE=3 SV=2 116 596 1.0E-90
sp|Q6WIH5|MEP1_ARTBE Extracellular metalloproteinase 1 OS=Arthroderma benhamiae GN=MEP1 PE=3 SV=1 129 596 2.0E-90
sp|B8XGR0|MEP1_TRITO Extracellular metalloproteinase 1 OS=Trichophyton tonsurans GN=MEP1 PE=3 SV=1 164 596 2.0E-90
sp|A1C4M2|MEP_ASPCL Extracellular metalloproteinase mep OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mep PE=3 SV=1 116 596 2.0E-90
sp|Q8NIB6|MEP1_TRIRU Extracellular metalloproteinase 1 OS=Trichophyton rubrum GN=MEP1 PE=1 SV=1 164 596 4.0E-90
sp|C5FX29|MEP5_ARTOC Extracellular metalloproteinase 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP5 PE=3 SV=2 168 596 5.0E-90
sp|Q6WIH7|MEP5_ARTOT Extracellular metalloproteinase 5 OS=Arthroderma otae GN=MEP5 PE=3 SV=1 168 596 5.0E-90
sp|A7UKV9|MEP1_TRIEQ Extracellular metalloproteinase 1 (Fragment) OS=Trichophyton equinum GN=MEP1 PE=3 SV=1 164 583 5.0E-90
sp|D4B1S5|MEP1_ARTBC Probable extracellular metalloproteinase 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP1 PE=1 SV=1 164 596 6.0E-90
sp|D4D4Z2|MEP1_TRIVH Probable extracellular metalloproteinase 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP1 PE=3 SV=2 164 596 9.0E-90
sp|E4UVK2|MEP5_ARTGP Extracellular metalloproteinase 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP5 PE=3 SV=1 164 583 4.0E-87
sp|Q8NIJ4|MEP4_TRIRU Extracellular metalloproteinase 4 OS=Trichophyton rubrum GN=MEP4 PE=1 SV=1 168 596 9.0E-87
sp|E4UUL6|MEP4_ARTGP Extracellular metalloproteinase 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP4 PE=3 SV=1 168 596 1.0E-86
sp|D4CZ44|MEP4_TRIVH Probable extracellular metalloproteinase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP4 PE=3 SV=1 168 596 6.0E-86
sp|D4AX35|MEP4_ARTBC Probable extracellular metalloproteinase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP4 PE=1 SV=1 168 596 2.0E-85
sp|Q6WIH8|MEP3_TRIRU Extracellular metalloproteinase 3 OS=Trichophyton rubrum GN=MEP3 PE=1 SV=1 177 596 4.0E-85
sp|Q6WIH1|MEP4_ARTBE Extracellular metalloproteinase 4 OS=Arthroderma benhamiae GN=MEP4 PE=1 SV=1 168 596 9.0E-85
sp|D4DHN5|MEP3_TRIVH Probable extracellular metalloproteinase 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP3 PE=3 SV=1 177 596 1.0E-84
sp|D4AL88|MEP3_ARTBC Probable extracellular metalloproteinase 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP3 PE=1 SV=1 177 596 1.0E-84
sp|C5NZT1|MEP9_COCP7 Extracellular metalloproteinase 9 OS=Coccidioides posadasii (strain C735) GN=MEP9 PE=3 SV=1 67 596 2.0E-84
sp|E4V5B2|MEP3_ARTGP Extracellular metalloproteinase 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP3 PE=2 SV=1 177 596 2.0E-84
sp|B6VA81|MEP4_TRIEQ Extracellular metalloproteinase 4 OS=Trichophyton equinum GN=MEP4 PE=1 SV=1 168 596 7.0E-84
sp|B6V874|MEP4_TRITO Extracellular metalloproteinase 4 OS=Trichophyton tonsurans GN=MEP4 PE=1 SV=1 168 596 7.0E-84
sp|Q8J0D6|MEP3_ARTOT Extracellular metalloproteinase 3 OS=Arthroderma otae GN=MEP3 PE=1 SV=1 129 596 8.0E-84
sp|C5FNU8|MEP3_ARTOC Extracellular metalloproteinase 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP3 PE=3 SV=1 129 596 8.0E-84
sp|E3QKL1|MEP_COLGM Extracellular metalloproteinase mep OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=mep PE=2 SV=1 129 596 1.0E-83
sp|B8XGR5|MEP3_TRIEQ Extracellular metalloproteinase 3 OS=Trichophyton equinum GN=MEP3 PE=1 SV=1 177 596 1.0E-83
sp|B6V9X0|MEP3_TRITO Extracellular metalloproteinase 3 OS=Trichophyton tonsurans GN=MEP3 PE=1 SV=1 177 596 2.0E-83
sp|E4UQ65|MEP2_ARTGP Extracellular metalloproteinase 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP2 PE=3 SV=1 101 596 2.0E-83
sp|Q6WIH6|MEP5_ARTBE Extracellular metalloproteinase 5 OS=Arthroderma benhamiae GN=MEP5 PE=3 SV=1 105 596 2.0E-83
sp|Q8J0D4|MEP2_ARTOT Extracellular metalloproteinase 2 OS=Arthroderma otae GN=MEP2 PE=3 SV=1 101 596 2.0E-83
sp|C5FJ19|MEP2_ARTOC Extracellular metalloproteinase 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP2 PE=3 SV=1 101 596 2.0E-83
sp|Q6WIH3|MEP3_ARTBE Extracellular metalloproteinase 3 OS=Arthroderma benhamiae GN=MEP3 PE=1 SV=1 177 596 2.0E-83
sp|A1XIM6|MEP4_TRIVO Extracellular metalloproteinase 4 (Fragment) OS=Trichophyton violaceum GN=MEP4 PE=1 SV=1 215 583 9.0E-83
sp|A1XIM5|MEP4_TRISD Extracellular metalloproteinase 4 (Fragment) OS=Trichophyton soudanense GN=MEP4 PE=1 SV=1 215 583 4.0E-82
sp|B2WKX9|MEP_PYRTR Extracellular metalloproteinase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=MEP PE=2 SV=1 51 583 6.0E-82
sp|C4JX59|MEP10_UNCRE Extracellular metalloproteinase 10 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MEP10 PE=3 SV=1 153 596 7.0E-82
sp|Q8NIE3|MEP2_TRIRU Extracellular metalloproteinase 2 OS=Trichophyton rubrum GN=MEP2 PE=1 SV=1 141 596 3.0E-81
sp|D4AYW3|MEP2_ARTBC Probable extracellular metalloproteinase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP2 PE=3 SV=1 141 596 5.0E-81
sp|D4D2D2|MEP2_TRIVH Probable extracellular metalloproteinase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP2 PE=3 SV=1 141 596 5.0E-81
sp|Q8NIH1|MEP5_TRIRU Extracellular metalloproteinase 5 OS=Trichophyton rubrum GN=MEP5 PE=1 SV=1 105 596 7.0E-81
sp|D4AQG5|MEP5_ARTBC Probable extracellular metalloproteinase 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP5 PE=3 SV=1 105 596 1.0E-80
sp|E4UYA3|MEP1_ARTGP Extracellular metalloproteinase 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP1 PE=3 SV=1 105 596 1.0E-80
sp|A5YCB9|MEP5_TRITO Extracellular metalloproteinase 5 OS=Trichophyton tonsurans GN=MEP5 PE=3 SV=2 105 577 2.0E-80
sp|B6V873|MEP2_TRITO Extracellular metalloproteinase 2 OS=Trichophyton tonsurans GN=MEP2 PE=3 SV=1 141 596 3.0E-80
sp|Q6WIH2|MEP2_ARTBE Extracellular metalloproteinase 2 OS=Arthroderma benhamiae GN=MEP2 PE=3 SV=1 141 596 5.0E-80
sp|Q0V671|MEP2_PHANO Extracellular metalloproteinase 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MEP2 PE=2 SV=1 10 587 6.0E-79
sp|D4DIT1|MEP5_TRIVH Probable extracellular metalloproteinase 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP5 PE=3 SV=1 105 596 7.0E-79
sp|Q0UC19|MEP1_PHANO Extracellular metalloproteinase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MEP1 PE=2 SV=2 164 596 2.0E-78
sp|Q2U1N5|NPIII_ASPOR Extracellular metalloproteinase NpIII OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpIII PE=2 SV=1 177 587 4.0E-78
sp|E4ZJL4|MEP_LEPMJ Extracellular metalloproteinase MEP OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=MEP PE=2 SV=1 175 583 5.0E-78
sp|B8NMK3|MEP2_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 168 595 1.0E-77
sp|C7Z3B7|MEP_NECH7 Extracellular metalloproteinase MEP OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MEP PE=2 SV=1 102 596 1.0E-77
sp|A1XIM2|MEP3_TRIVO Extracellular metalloproteinase 3 (Fragment) OS=Trichophyton violaceum GN=MEP3 PE=1 SV=1 218 583 3.0E-77
sp|A1XIM1|MEP3_TRISD Extracellular metalloproteinase 3 (Fragment) OS=Trichophyton soudanense GN=MEP3 PE=1 SV=1 218 583 3.0E-77
sp|Q0CFJ0|MEP_ASPTN Extracellular metalloproteinase mep OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mep PE=2 SV=1 105 584 7.0E-76
sp|A7UKW1|MEP2_TRIEQ Extracellular metalloproteinase 2 (Fragment) OS=Trichophyton equinum GN=MEP2 PE=3 SV=1 141 576 4.0E-75
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0005615 extracellular space Yes
GO:0008233 peptidase activity No
GO:0004175 endopeptidase activity No
GO:0046914 transition metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015430
MVVFNKFFTSVVLAAVCATSSVSAAPWPASSKHATHRKRSLPNGVTFETFHPASSLETFGAGLDHPLAKSASQDL
KDAAVTFVTERLNIEASAVKHRTDSATDIITNAFLTQQHDDIPFANAVANVAFKNNKIVSFGHSFVKPTSIAAST
PTVSVEDAIAAAEKKLDGKFNDHPPTLEFLVKEDKSVVLTHVVQIQDEEAGTWFEAFVDAHSGEVVSITDFVDEA
SFRVIPIERNSVNDGFQTIQDPADLAASPNGWNNNGSPTTDTSGNNVITFKGTQSSTTQQSGSGNQFIFNFDASR
QPSFQANLDAARTNAFYVVNTVHDFTYRYGFNEANFNFQNNNFGKGGSGNDRVTVSVQDSSGLNNANFGTPPDGQ
SGQMRMFLWDRTNPMRDGALENDIVVHENTHGVTNRLVGGGTARCLRGLESGGMGEGWSDAMADWSEKTSSAVPD
FSPGTYVINSSSGIRSFPYSTSSSVNPLTYGDLSRLDEVHDIGEVWANILHNVYAALVGAHGWSATARTNPNGTQ
GNVVHMHLFIDSLQLMPCNPTFLSARDAWIQADENRYDGANRCTLWRAFASRGLGVNAANHRDDSSVPSGC*
Coding >AgabiH97|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTAGTGTTGGCAGCTGTTTGTGCCACGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGACATTTGGTGCTGGGCTCGACCATCCATTGGCTAAGAGTGCCTCACAAGATCTG
AAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGCGGTTAAACATAGGACGGATTCC
GCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGATGACATTCCGTTTGCTAATGCCGTTGCCAAT
GTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTTGTCAAACCAACGTCTATTGCTGCTTCGACG
CCGACCGTCTCTGTTGAGGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGCAAATTCAATGACCATCCTCCG
ACTCTTGAATTCTTGGTCAAGGAAGATAAGAGTGTCGTTTTGACACATGTCGTTCAGATCCAGGATGAAGAAGCT
GGGACCTGGTTCGAAGCTTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCG
AGCTTCCGCGTCATTCCTATCGAGAGGAATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTG
GCTGCTTCACCTAATGGGTGGAATAATAATGGTTCTCCCACTACTGACACCTCTGGAAACAATGTTATAACATTC
AAAGGTACCCAGTCTTCGACGACGCAACAATCTGGATCTGGCAATCAATTTATCTTCAACTTCGACGCGAGTAGA
CAACCTTCTTTCCAAGCTAACCTCGATGCTGCTCGCACCAACGCTTTCTACGTCGTCAACACCGTCCATGACTTT
ACTTATCGATATGGCTTCAACGAGGCGAACTTCAACTTCCAAAACAACAACTTTGGTAAGGGTGGCAGTGGTAAT
GATCGCGTTACTGTGTCTGTTCAAGACTCGAGTGGTTTGAACAACGCTAACTTTGGTACTCCTCCCGATGGCCAA
TCCGGACAAATGCGTATGTTCTTATGGGATCGTACGAACCCCATGCGCGACGGTGCTCTGGAGAATGATATTGTC
GTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGCGGAACTGCACGTTGCTTGCGTGGTCTTGAA
TCTGGTGGTATGGGTGAAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCGGCTGTTCCTGAC
TTCTCCCCCGGTACATACGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATACTCGACGTCATCTTCCGTC
AATCCTTTGACCTACGGGGATCTCAGTAGACTGGATGAAGTCCATGACATCGGTGAAGTCTGGGCTAATATCCTC
CACAATGTTTATGCTGCACTTGTTGGCGCTCACGGTTGGTCCGCAACAGCACGCACGAACCCCAATGGCACCCAA
GGCAATGTTGTACACATGCATCTCTTCATTGACTCTCTTCAACTTATGCCTTGCAATCCTACATTCCTTTCGGCT
CGTGATGCTTGGATCCAAGCTGATGAGAACAGGTATGACGGAGCTAATAGATGTACACTCTGGAGAGCATTTGCT
AGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGAGATGACTCTTCGGTTCCTAGTGGTTGTTAG
Transcript >AgabiH97|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTAGTGTTGGCAGCTGTTTGTGCCACGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGACATTTGGTGCTGGGCTCGACCATCCATTGGCTAAGAGTGCCTCACAAGATCTG
AAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGCGGTTAAACATAGGACGGATTCC
GCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGATGACATTCCGTTTGCTAATGCCGTTGCCAAT
GTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTTGTCAAACCAACGTCTATTGCTGCTTCGACG
CCGACCGTCTCTGTTGAGGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGCAAATTCAATGACCATCCTCCG
ACTCTTGAATTCTTGGTCAAGGAAGATAAGAGTGTCGTTTTGACACATGTCGTTCAGATCCAGGATGAAGAAGCT
GGGACCTGGTTCGAAGCTTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCG
AGCTTCCGCGTCATTCCTATCGAGAGGAATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTG
GCTGCTTCACCTAATGGGTGGAATAATAATGGTTCTCCCACTACTGACACCTCTGGAAACAATGTTATAACATTC
AAAGGTACCCAGTCTTCGACGACGCAACAATCTGGATCTGGCAATCAATTTATCTTCAACTTCGACGCGAGTAGA
CAACCTTCTTTCCAAGCTAACCTCGATGCTGCTCGCACCAACGCTTTCTACGTCGTCAACACCGTCCATGACTTT
ACTTATCGATATGGCTTCAACGAGGCGAACTTCAACTTCCAAAACAACAACTTTGGTAAGGGTGGCAGTGGTAAT
GATCGCGTTACTGTGTCTGTTCAAGACTCGAGTGGTTTGAACAACGCTAACTTTGGTACTCCTCCCGATGGCCAA
TCCGGACAAATGCGTATGTTCTTATGGGATCGTACGAACCCCATGCGCGACGGTGCTCTGGAGAATGATATTGTC
GTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGCGGAACTGCACGTTGCTTGCGTGGTCTTGAA
TCTGGTGGTATGGGTGAAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCGGCTGTTCCTGAC
TTCTCCCCCGGTACATACGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATACTCGACGTCATCTTCCGTC
AATCCTTTGACCTACGGGGATCTCAGTAGACTGGATGAAGTCCATGACATCGGTGAAGTCTGGGCTAATATCCTC
CACAATGTTTATGCTGCACTTGTTGGCGCTCACGGTTGGTCCGCAACAGCACGCACGAACCCCAATGGCACCCAA
GGCAATGTTGTACACATGCATCTCTTCATTGACTCTCTTCAACTTATGCCTTGCAATCCTACATTCCTTTCGGCT
CGTGATGCTTGGATCCAAGCTGATGAGAACAGGTATGACGGAGCTAATAGATGTACACTCTGGAGAGCATTTGCT
AGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGAGATGACTCTTCGGTTCCTAGTGGTTGTTAG
Gene >AgabiH97|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTAGTGTTGGCAGCTGTTTGTGCCACGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGGTACGCTTTTTACACGCATATTTTTGACCTACTCGAGGGGTCGCTGATGTACTG
TTTTTCTTCATTTTTCTTTGCTTTTTTTAGACATTTGGTGCTGGGCTCGACCATCCATTGGCTAAGAGTGCCTCA
CAAGATCTGAAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGCGGTTAAACATAGG
ACGGATTCCGCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGTGAGTTTGAGTTTCGTATTTTTA
GTTTGGAAATGCCCACTAATGACATGTGATCTTTTCCTTCCCAGGATGACATTCCGTTTGCTAATGCCGTTGCCA
ATGTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTTGTCAAACCAAGTAAGATTTAAATTTCAG
CTTGTCCTGGTTTATGGTTATGCTGATTGATGATGTAGCGTCTATTGCTGCTTCGACGCCGACCGTCTCTGTTGA
GGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGCAAATTCAATGACCATCCTCCGACTCTTGAATTCTTGGT
CAAGGAAGATAAGAGTGTCGTTTTGACACATGTCGTTCAGATCCAGGATGAAGAAGCTGGGACCTGGTTCGAAGC
TTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCGAGCGTGAGTTTTGTTTG
TATTCTTTCTTGTCGTGTTTATGATGGCTGATATACATTTATGGGTTTCAGTTCCGCGTCATTCCTATCGAGAGG
AATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTGGCTGCTTCACCTAATGGGTGGAATAAT
AATGGTTCTCCCACTACGTGAGCGTCCATTTGTATGATTATTAATGGCTCGTCGCTAAGGGAAATTTCTCACTAG
TGACACCTCGTGAGTTAAACCTGTTCAAAATGAAGTCAGCTGTTTCTAAGATCATCATTTTCATTTCAGTGGAAA
CAATGTTATAACATTCAAAGGTACCCAGTCTTCGACGACGCAACAATCTGGATCTGGCAATCAATTTATCTTCAA
CTTCGACGCGAGTAGACAACCTTCTTTCCAAGCTAACCTCGATGCTGCTCGCACCAACGCTTTCTACGTCGTCAA
CACCGTCCATGACTTTACTTATCGGTATGTATAATGTTCTTATTTATTCTAAGTGCGTCACTTAACTGTAAATTT
AGATATGGCTTCAACGAGGTATGCCAAATGGAATTTTGTGATGACTGACTGGATAGTGACCGCTGCTCTATAGGC
GAACTTCAACTTCCAAAACAACAACTTTGGTAAGGGTGGCAGTGGTAATGATCGCGTTACTGTGTCTGTTCAAGA
CTCGAGTGGTTTGAACAACGCTAACTTTGGTACTCCTCCCGAGTAAGTCGACCTCGTTTTTTGGATTATTTTCAT
TTATTGATAAGTTTTCTTTAGTGGCCAATCCGGACAAATGCGTATGTTCTTATGGGATCGTACGAACGTAAGTTT
GTTGTGCTTTCGTCGGTATGATTCGTTCGCTAATTCTGTATTCTTAGCCCATGCGCGACGGTGCTCTGGAGAATG
ATATTGTCGTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGCGGAACTGCACGTTGCTTGCGTG
GTCTTGAATCTGGTGGTATGGGTGAAGGTAAAGGAAGTTTTTTCAACATCATCAAACCATTTTTCTCAATTTACT
TTTCTTACAAATAATAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCGGCTGTTCCTGACTT
CTCCCCCGGTACATACGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATACTCGACGTCATCGTGAGTCCC
GTTGGCCGTTCGTGCACTTTCCTTTCACTTATGGTTGTGTAGTTCCGTCAATCCTTTGACCTACGGGGATCTCAG
TAGACTGGATGAAGTCCATGGTGAGTTAGCCTATCATGAGGATCAAGGATTGGTTTTAATATTCATGCGTTTGGA
TAGACATCGGTGAAGTCTGGGCTAATATCCTCCACAATGTTTATGCTGCACTTGTTGGCGCTCACGGTTGGTCCG
CAACAGCACGCACGAACCCCAATGGCACCCAAGGCAATGTTGTACACATGCATCTCTTCATTGACTCTCTTCAAC
TTATGCCTTGCAATCCTACATGTGAGTCGCGCTGATATATTTCAACTAATAGAAATATGAATAGCGATGCTAACT
CATATGCTATATAGTCCTTTCGGCTCGTGATGCTTGGATCCAAGCTGATGAGAACAGGTATGACGGAGCTAATAG
ATGTACACTCTGGAGAGCATTTGCTAGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGAGATGACTCTTCGGT
TCCTAGTGGTTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail