Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015390
Gene name
Locationscaffold_10:136709..137634
Strand-
Gene length (bp)925
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05724 TPMT Thiopurine S-methyltransferase (TPMT) 2.6E-32 32 208
PF13649 Methyltransf_25 Methyltransferase domain 7.0E-11 79 172
PF13847 Methyltransf_31 Methyltransferase domain 9.1E-09 78 176
PF08241 Methyltransf_11 Methyltransferase domain 1.5E-07 77 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 24 234 1.0E-40
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 19 232 2.0E-35
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 20 232 2.0E-35
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 35 232 4.0E-32
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 19 225 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 24 234 1.0E-40
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 19 232 2.0E-35
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 20 232 2.0E-35
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 35 232 4.0E-32
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 19 225 3.0E-30
sp|A1S2Z7|TPMT_SHEAM Thiopurine S-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tpm PE=3 SV=1 31 210 3.0E-11
sp|A5F1V4|TPMT_VIBC3 Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tpm PE=3 SV=1 31 193 4.0E-11
sp|Q0HR25|TPMT_SHESR Thiopurine S-methyltransferase OS=Shewanella sp. (strain MR-7) GN=tpm PE=3 SV=1 31 207 6.0E-11
sp|C3LLS2|TPMT_VIBCM Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tpm PE=3 SV=1 31 193 6.0E-11
sp|Q9KSN0|TPMT_VIBCH Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tpm PE=3 SV=1 31 193 6.0E-11
sp|Q0HMQ6|TPMT_SHESM Thiopurine S-methyltransferase OS=Shewanella sp. (strain MR-4) GN=tpm PE=3 SV=1 31 207 8.0E-11
sp|C3K732|TPMT_PSEFS Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=tpm PE=3 SV=1 31 193 5.0E-10
sp|A0KSQ0|TPMT_SHESA Thiopurine S-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=tpm PE=3 SV=1 31 207 4.0E-09
sp|B5FEQ9|TPMT_VIBFM Thiopurine S-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=tpm PE=3 SV=1 31 193 4.0E-09
sp|B7VPF3|TPMT_VIBTL Thiopurine S-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=tpm PE=3 SV=1 32 193 4.0E-09
sp|Q5WSX9|TPMT_LEGPL Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Lens) GN=tpm PE=3 SV=1 35 215 5.0E-09
sp|Q87Q54|TPMT_VIBPA Thiopurine S-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tpm PE=3 SV=1 69 193 6.0E-09
sp|Q3K932|TPMT_PSEPF Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tpm PE=3 SV=1 31 193 7.0E-09
sp|Q5E4N9|TPMT_VIBF1 Thiopurine S-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tpm PE=3 SV=1 31 207 7.0E-09
sp|Q5X154|TPMT_LEGPA Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Paris) GN=tpm PE=3 SV=1 35 215 7.0E-09
sp|B6ENK8|TPMT_ALISL Thiopurine S-methyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=tpm PE=3 SV=1 35 193 2.0E-08
sp|Q5ZRP5|TPMT_LEGPH Thiopurine S-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tpm PE=3 SV=1 35 196 2.0E-08
sp|Q17QQ2|TPMT_BOVIN Thiopurine S-methyltransferase OS=Bos taurus GN=TPMT PE=2 SV=1 35 193 3.0E-08
sp|B8ECC0|TPMT_SHEB2 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS223) GN=tpm PE=3 SV=1 31 207 5.0E-08
sp|Q12RU3|TPMT_SHEDO Thiopurine S-methyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tpm PE=3 SV=1 31 207 6.0E-08
sp|A7MVH9|TPMT_VIBCB Thiopurine S-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tpm PE=3 SV=1 69 200 6.0E-08
sp|Q6LRI5|TPMT_PHOPR Thiopurine S-methyltransferase OS=Photobacterium profundum GN=tpm PE=3 SV=1 35 193 8.0E-08
sp|A3D007|TPMT_SHEB5 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tpm PE=3 SV=1 31 207 9.0E-08
sp|A6WSW9|TPMT_SHEB8 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS185) GN=tpm PE=3 SV=1 31 207 1.0E-07
sp|B1KHT1|TPMT_SHEWM Thiopurine S-methyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tpm PE=3 SV=1 31 193 2.0E-07
sp|A5II06|TPMT_LEGPC Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Corby) GN=tpm PE=3 SV=1 35 215 2.0E-07
sp|Q8EJ86|TPMT_SHEON Thiopurine S-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=tpm PE=3 SV=1 73 207 3.0E-07
sp|A1KG37|Y605_MYCBP Uncharacterized protein BCG_0605c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0605c PE=1 SV=1 45 179 4.0E-07
sp|P9WKL4|Y560_MYCTO Uncharacterized protein MT0586 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0586 PE=3 SV=1 45 179 4.0E-07
sp|P9WKL5|Y560_MYCTU Uncharacterized protein Rv0560c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0560c PE=1 SV=1 45 179 4.0E-07
sp|A5TZU0|Y567_MYCTA Uncharacterized protein MRA_0567 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_0567 PE=1 SV=1 45 179 4.0E-07
sp|A9L3X6|TPMT_SHEB9 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS195) GN=tpm PE=3 SV=1 31 207 4.0E-07
sp|Q4K8U2|TPMT_PSEF5 Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tpm PE=3 SV=1 35 222 4.0E-07
sp|Q3BCQ8|TPMT_RABIT Thiopurine S-methyltransferase OS=Oryctolagus cuniculus GN=TPMT PE=2 SV=1 39 193 4.0E-07
sp|Q9Z0T0|TPMT_RAT Thiopurine S-methyltransferase OS=Rattus norvegicus GN=Tpmt PE=2 SV=1 35 193 5.0E-07
sp|Q504A5|TPMT_DANRE Probable thiopurine S-methyltransferase OS=Danio rerio GN=tpmt PE=2 SV=1 29 193 5.0E-07
sp|A3QI29|TPMT_SHELP Thiopurine S-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tpm PE=3 SV=1 31 207 8.0E-07
sp|A4XVB5|TPMT_PSEMY Thiopurine S-methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=tpm PE=3 SV=1 67 193 2.0E-06
sp|A0Q3W9|TPMT_FRATN Thiopurine S-methyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=tpm PE=3 SV=1 35 235 2.0E-06
sp|Q7MK46|TPMT_VIBVY Thiopurine S-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=tpm PE=3 SV=1 35 196 5.0E-06
sp|Q8DA33|TPMT_VIBVU Thiopurine S-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=tpm PE=3 SV=1 35 196 5.0E-06
sp|Q60AQ2|TPMT_METCA Thiopurine S-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tpm PE=3 SV=1 31 193 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 36.36 18.66 54.07
Initials Initials knots 76.01 43.56 108.47
Pileal_Stipeal_center Stage I stipe center 70.15 39.65 100.66
Pileal_Stipeal_shell Stage I stipe shell 113.85 67.15 160.54
DIF_stipe_center Stage II stipe center 45.43 24.06 66.80
DIF_stipe_shell Stage II stipe shell 85.70 47.72 123.68
DIF_stipe_skin Stage II stipe skin 72.68 40.74 104.62
DIF_cap_skin Stage II cap skin 144.86 86.05 203.68
DIF_cap_tissue Stage II cap tissue 111.14 64.53 157.74
DIF_gill_tissue Stage II gill tissue 79.50 45.05 113.96
YFB_stipe_center Young fruiting body stipe center 55.71 30.88 80.53
YFB_stipe_shell Young fruiting body stipe shell 70.58 40.24 100.93
YFB_stipe_skin Young fruiting body stipe skin 46.85 25.43 68.26
YFB_cap_skin Young fruiting body cap skin 209.59 125.82 293.36
YFB_cap_tissue Young fruiting body cap tissue 134.80 79.81 189.80
YFB_gill_tissue Young fruiting body gill tissue 236.75 129.29 344.21
YFB_veil Young fruiting body veil 118.09 68.87 167.31

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.007439 yes
Casing YFB_stipe_center 0.219634 no
Casing YFB_stipe_shell 0.026955 yes
Casing YFB_stipe_skin 0.547977 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.011350 yes
Casing Pileal_Stipeal_center 0.031557 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.622867 no
Casing DIF_stipe_shell 0.003765 yes
Casing DIF_stipe_skin 0.018896 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.297777 no
DIF_gill_tissue YFB_stipe_shell 0.802005 no
DIF_gill_tissue YFB_stipe_skin 0.087927 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.065649 no
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.203756 no
YFB_stipe_center YFB_stipe_shell 0.542444 no
YFB_stipe_center YFB_stipe_skin 0.704331 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.006032 yes
YFB_stipe_shell YFB_stipe_skin 0.211006 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.014374 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.071968 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.111638 no
YFB_cap_skin YFB_gill_tissue 0.793288 no
YFB_cap_skin YFB_veil 0.033674 yes
YFB_cap_tissue YFB_gill_tissue 0.045487 yes
YFB_cap_tissue YFB_veil 0.763862 no
YFB_gill_tissue YFB_veil 0.012880 yes
Initials DIF_gill_tissue 0.937173 no
Initials YFB_stipe_center 0.381882 no
Initials YFB_stipe_shell 0.888941 no
Initials YFB_stipe_skin 0.120521 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.038495 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.142929 no
Initials Pileal_Stipeal_center 0.881180 no
Initials Pileal_Stipeal_shell 0.181451 no
Initials DIF_stipe_center 0.101215 no
Initials DIF_stipe_shell 0.809416 no
Initials DIF_stipe_skin 0.938024 no
Initials DIF_cap_skin 0.016386 yes
Initials DIF_cap_tissue 0.218974 no
Pileal_Stipeal_center DIF_gill_tissue 0.795320 no
Pileal_Stipeal_center YFB_stipe_center 0.572540 no
Pileal_Stipeal_center YFB_stipe_shell 0.991164 no
Pileal_Stipeal_center YFB_stipe_skin 0.230769 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.018344 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.081583 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.100086 no
Pileal_Stipeal_center DIF_stipe_center 0.197235 no
Pileal_Stipeal_center DIF_stipe_shell 0.639885 no
Pileal_Stipeal_center DIF_stipe_skin 0.951299 no
Pileal_Stipeal_center DIF_cap_skin 0.007092 yes
Pileal_Stipeal_center DIF_cap_tissue 0.127636 no
Pileal_Stipeal_shell DIF_gill_tissue 0.260498 no
Pileal_Stipeal_shell YFB_stipe_center 0.009773 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.095644 no
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.017783 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.674181 no
Pileal_Stipeal_shell YFB_gill_tissue 0.007439 yes
Pileal_Stipeal_shell YFB_veil 0.947829 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.421378 no
Pileal_Stipeal_shell DIF_stipe_skin 0.122909 no
Pileal_Stipeal_shell DIF_cap_skin 0.491424 no
Pileal_Stipeal_shell DIF_cap_tissue 0.965689 no
DIF_stipe_center DIF_gill_tissue 0.067334 no
DIF_stipe_center YFB_stipe_center 0.648493 no
DIF_stipe_center YFB_stipe_shell 0.170490 no
DIF_stipe_center YFB_stipe_skin 0.962244 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.035309 yes
DIF_stipe_center DIF_stipe_skin 0.134864 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.002084 yes
DIF_stipe_shell DIF_gill_tissue 0.889150 no
DIF_stipe_shell YFB_stipe_center 0.191804 no
DIF_stipe_shell YFB_stipe_shell 0.644396 no
DIF_stipe_shell YFB_stipe_skin 0.046952 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.136312 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.352257 no
DIF_stipe_shell DIF_stipe_skin 0.714926 no
DIF_stipe_shell DIF_cap_skin 0.074661 no
DIF_stipe_shell DIF_cap_tissue 0.482560 no
DIF_stipe_skin DIF_gill_tissue 0.861481 no
DIF_stipe_skin YFB_stipe_center 0.484215 no
DIF_stipe_skin YFB_stipe_shell 0.958528 no
DIF_stipe_skin YFB_stipe_skin 0.176804 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.024444 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.100566 no
DIF_stipe_skin DIF_cap_skin 0.011659 yes
DIF_stipe_skin DIF_cap_tissue 0.160642 no
DIF_cap_skin DIF_gill_tissue 0.031088 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.005671 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.218427 no
DIF_cap_skin YFB_cap_tissue 0.883277 no
DIF_cap_skin YFB_gill_tissue 0.097447 no
DIF_cap_skin YFB_veil 0.592573 no
DIF_cap_skin DIF_cap_tissue 0.441291 no
DIF_cap_tissue DIF_gill_tissue 0.315328 no
DIF_cap_tissue YFB_stipe_center 0.014956 yes
DIF_cap_tissue YFB_stipe_shell 0.131844 no
DIF_cap_tissue YFB_stipe_skin 0.002084 yes
DIF_cap_tissue YFB_cap_skin 0.016386 yes
DIF_cap_tissue YFB_cap_tissue 0.617463 no
DIF_cap_tissue YFB_gill_tissue 0.005671 yes
DIF_cap_tissue YFB_veil 0.908196 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015390
MSGTGPISQPFNFRTDSEPAKAVRKLVDVYEPSTWNKAWQASVTPWDAGEFQPPLKEVIETNIDGIQWPNQTGKA
LVPGCGTGYDAVYLASTLGVHAIGLDSSEIAVDKASASVNDRPLTKGKATFELADFFKYSSNEGFDLVYDYTFFV
AIPPSRRNEWGAKMAELIKPGGYLITLIFPIDPKSDVGPPFYVRPEHYDEPLSSNFEKVIERIPETSRESHKGRE
RVAVWRRKAE*
Coding >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGCGAGCGTAACACCTTGGGATGCGGGAGAA
TTCCAACCGCCACTTAAAGAAGTCATCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCC
CTTGTTCCAGGATGTGGTACCGGATATGATGCTGTCTATCTCGCGTCTACCCTTGGAGTCCATGCCATAGGCCTT
GATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCTTCCGTGAACGATAGGCCCCTTACCAAGGGAAAAGCAACA
TTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATTATACGTTTTTCGTT
GCTATACCGCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATA
ACGCTGATCTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAG
CCGCTTTCTTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAG
AGAGTGGCAGTTTGGAGAAGGAAAGCCGAGTAA
Transcript >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGCGAGCGTAACACCTTGGGATGCGGGAGAA
TTCCAACCGCCACTTAAAGAAGTCATCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCC
CTTGTTCCAGGATGTGGTACCGGATATGATGCTGTCTATCTCGCGTCTACCCTTGGAGTCCATGCCATAGGCCTT
GATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCTTCCGTGAACGATAGGCCCCTTACCAAGGGAAAAGCAACA
TTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATTATACGTTTTTCGTT
GCTATACCGCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATA
ACGCTGATCTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAG
CCGCTTTCTTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAG
AGAGTGGCAGTTTGGAGAAGGAAAGCCGAGTAA
Gene >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGTACTCCAACGTTCGAGTTCCATATCAGAT
TAAACAATTCCAAAAGGGAGGCGAGCGTAACACCTTGGGATGCGGGAGAATTCCAACCGCCACTTAAAGAAGTCA
TCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCCCTTGTTCCAGGATGTGGTACCGTAA
GTCGCTTTAAACACTAGTCGGCGTTGCCGTGAATAACTTTTGCACAAGGGATATGATGCTGTCTATCTCGCGTCT
ACCCTTGGAGTCCATGCCATAGGCCTTGATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCGTGCGTCTCGTTT
CTGAACTTCTTCCCGCAAAAATCAATGATTCTGTTGTGGATAATCACAGTTCCGTGAACGATAGGCCCCTTACCA
AGGGAAAAGCAACATTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATT
ATACGTGAGGAATCTATTTCCACCATGAACTTGAAGTCAAAACAACTATTTTGCTAGGTTTTTCGTTGCTATACC
GCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATAACGCTGAT
CTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAGCCGCTTTC
TTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAGAGAGTGGC
AGTTTGGAGAAGGAAAGCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail