Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015390
Gene name
Locationscaffold_10:136709..137634
Strand-
Gene length (bp)925
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05724 TPMT Thiopurine S-methyltransferase (TPMT) 2.6E-32 32 208
PF13649 Methyltransf_25 Methyltransferase domain 7.0E-11 79 172
PF13847 Methyltransf_31 Methyltransferase domain 9.1E-09 78 176
PF08241 Methyltransf_11 Methyltransferase domain 1.5E-07 77 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 24 234 1.0E-40
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 19 232 2.0E-35
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 20 232 2.0E-35
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 35 232 4.0E-32
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 19 225 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AWU6|HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana GN=HOL3 PE=1 SV=1 24 234 1.0E-40
sp|Q93V78|TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea GN=TMT1 PE=1 SV=1 19 232 2.0E-35
sp|Q93XC4|TMT2_BRAOL Probable thiocyanate methyltransferase 2 OS=Brassica oleracea GN=TMT2 PE=2 SV=1 20 232 2.0E-35
sp|O80562|HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana GN=HOL2 PE=1 SV=1 35 232 4.0E-32
sp|Q0WP12|HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana GN=HOL1 PE=1 SV=1 19 225 3.0E-30
sp|A1S2Z7|TPMT_SHEAM Thiopurine S-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tpm PE=3 SV=1 31 210 3.0E-11
sp|A5F1V4|TPMT_VIBC3 Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tpm PE=3 SV=1 31 193 4.0E-11
sp|Q0HR25|TPMT_SHESR Thiopurine S-methyltransferase OS=Shewanella sp. (strain MR-7) GN=tpm PE=3 SV=1 31 207 6.0E-11
sp|C3LLS2|TPMT_VIBCM Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tpm PE=3 SV=1 31 193 6.0E-11
sp|Q9KSN0|TPMT_VIBCH Thiopurine S-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tpm PE=3 SV=1 31 193 6.0E-11
sp|Q0HMQ6|TPMT_SHESM Thiopurine S-methyltransferase OS=Shewanella sp. (strain MR-4) GN=tpm PE=3 SV=1 31 207 8.0E-11
sp|C3K732|TPMT_PSEFS Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=tpm PE=3 SV=1 31 193 5.0E-10
sp|A0KSQ0|TPMT_SHESA Thiopurine S-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=tpm PE=3 SV=1 31 207 4.0E-09
sp|B5FEQ9|TPMT_VIBFM Thiopurine S-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=tpm PE=3 SV=1 31 193 4.0E-09
sp|B7VPF3|TPMT_VIBTL Thiopurine S-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=tpm PE=3 SV=1 32 193 4.0E-09
sp|Q5WSX9|TPMT_LEGPL Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Lens) GN=tpm PE=3 SV=1 35 215 5.0E-09
sp|Q87Q54|TPMT_VIBPA Thiopurine S-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tpm PE=3 SV=1 69 193 6.0E-09
sp|Q3K932|TPMT_PSEPF Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tpm PE=3 SV=1 31 193 7.0E-09
sp|Q5E4N9|TPMT_VIBF1 Thiopurine S-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tpm PE=3 SV=1 31 207 7.0E-09
sp|Q5X154|TPMT_LEGPA Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Paris) GN=tpm PE=3 SV=1 35 215 7.0E-09
sp|B6ENK8|TPMT_ALISL Thiopurine S-methyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=tpm PE=3 SV=1 35 193 2.0E-08
sp|Q5ZRP5|TPMT_LEGPH Thiopurine S-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tpm PE=3 SV=1 35 196 2.0E-08
sp|Q17QQ2|TPMT_BOVIN Thiopurine S-methyltransferase OS=Bos taurus GN=TPMT PE=2 SV=1 35 193 3.0E-08
sp|B8ECC0|TPMT_SHEB2 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS223) GN=tpm PE=3 SV=1 31 207 5.0E-08
sp|Q12RU3|TPMT_SHEDO Thiopurine S-methyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tpm PE=3 SV=1 31 207 6.0E-08
sp|A7MVH9|TPMT_VIBCB Thiopurine S-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tpm PE=3 SV=1 69 200 6.0E-08
sp|Q6LRI5|TPMT_PHOPR Thiopurine S-methyltransferase OS=Photobacterium profundum GN=tpm PE=3 SV=1 35 193 8.0E-08
sp|A3D007|TPMT_SHEB5 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tpm PE=3 SV=1 31 207 9.0E-08
sp|A6WSW9|TPMT_SHEB8 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS185) GN=tpm PE=3 SV=1 31 207 1.0E-07
sp|B1KHT1|TPMT_SHEWM Thiopurine S-methyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tpm PE=3 SV=1 31 193 2.0E-07
sp|A5II06|TPMT_LEGPC Thiopurine S-methyltransferase OS=Legionella pneumophila (strain Corby) GN=tpm PE=3 SV=1 35 215 2.0E-07
sp|Q8EJ86|TPMT_SHEON Thiopurine S-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=tpm PE=3 SV=1 73 207 3.0E-07
sp|A1KG37|Y605_MYCBP Uncharacterized protein BCG_0605c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0605c PE=1 SV=1 45 179 4.0E-07
sp|P9WKL4|Y560_MYCTO Uncharacterized protein MT0586 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0586 PE=3 SV=1 45 179 4.0E-07
sp|P9WKL5|Y560_MYCTU Uncharacterized protein Rv0560c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0560c PE=1 SV=1 45 179 4.0E-07
sp|A5TZU0|Y567_MYCTA Uncharacterized protein MRA_0567 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_0567 PE=1 SV=1 45 179 4.0E-07
sp|A9L3X6|TPMT_SHEB9 Thiopurine S-methyltransferase OS=Shewanella baltica (strain OS195) GN=tpm PE=3 SV=1 31 207 4.0E-07
sp|Q4K8U2|TPMT_PSEF5 Thiopurine S-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tpm PE=3 SV=1 35 222 4.0E-07
sp|Q3BCQ8|TPMT_RABIT Thiopurine S-methyltransferase OS=Oryctolagus cuniculus GN=TPMT PE=2 SV=1 39 193 4.0E-07
sp|Q9Z0T0|TPMT_RAT Thiopurine S-methyltransferase OS=Rattus norvegicus GN=Tpmt PE=2 SV=1 35 193 5.0E-07
sp|Q504A5|TPMT_DANRE Probable thiopurine S-methyltransferase OS=Danio rerio GN=tpmt PE=2 SV=1 29 193 5.0E-07
sp|A3QI29|TPMT_SHELP Thiopurine S-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tpm PE=3 SV=1 31 207 8.0E-07
sp|A4XVB5|TPMT_PSEMY Thiopurine S-methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=tpm PE=3 SV=1 67 193 2.0E-06
sp|A0Q3W9|TPMT_FRATN Thiopurine S-methyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=tpm PE=3 SV=1 35 235 2.0E-06
sp|Q7MK46|TPMT_VIBVY Thiopurine S-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=tpm PE=3 SV=1 35 196 5.0E-06
sp|Q8DA33|TPMT_VIBVU Thiopurine S-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=tpm PE=3 SV=1 35 196 5.0E-06
sp|Q60AQ2|TPMT_METCA Thiopurine S-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tpm PE=3 SV=1 31 193 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015390
MSGTGPISQPFNFRTDSEPAKAVRKLVDVYEPSTWNKAWQASVTPWDAGEFQPPLKEVIETNIDGIQWPNQTGKA
LVPGCGTGYDAVYLASTLGVHAIGLDSSEIAVDKASASVNDRPLTKGKATFELADFFKYSSNEGFDLVYDYTFFV
AIPPSRRNEWGAKMAELIKPGGYLITLIFPIDPKSDVGPPFYVRPEHYDEPLSSNFEKVIERIPETSRESHKGRE
RVAVWRRKAE*
Coding >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGCGAGCGTAACACCTTGGGATGCGGGAGAA
TTCCAACCGCCACTTAAAGAAGTCATCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCC
CTTGTTCCAGGATGTGGTACCGGATATGATGCTGTCTATCTCGCGTCTACCCTTGGAGTCCATGCCATAGGCCTT
GATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCTTCCGTGAACGATAGGCCCCTTACCAAGGGAAAAGCAACA
TTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATTATACGTTTTTCGTT
GCTATACCGCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATA
ACGCTGATCTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAG
CCGCTTTCTTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAG
AGAGTGGCAGTTTGGAGAAGGAAAGCCGAGTAA
Transcript >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGCGAGCGTAACACCTTGGGATGCGGGAGAA
TTCCAACCGCCACTTAAAGAAGTCATCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCC
CTTGTTCCAGGATGTGGTACCGGATATGATGCTGTCTATCTCGCGTCTACCCTTGGAGTCCATGCCATAGGCCTT
GATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCTTCCGTGAACGATAGGCCCCTTACCAAGGGAAAAGCAACA
TTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATTATACGTTTTTCGTT
GCTATACCGCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATA
ACGCTGATCTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAG
CCGCTTTCTTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAG
AGAGTGGCAGTTTGGAGAAGGAAAGCCGAGTAA
Gene >AgabiH97|015390
ATGAGTGGAACTGGTCCTATAAGTCAACCCTTCAACTTCAGAACCGACTCTGAGCCAGCAAAGGCGGTGCGAAAG
CTCGTCGACGTATACGAACCGAGTACCTGGAACAAGGCATGGCAAGTACTCCAACGTTCGAGTTCCATATCAGAT
TAAACAATTCCAAAAGGGAGGCGAGCGTAACACCTTGGGATGCGGGAGAATTCCAACCGCCACTTAAAGAAGTCA
TCGAAACTAATATTGACGGGATACAATGGCCGAATCAAACAGGCAAAGCCCTTGTTCCAGGATGTGGTACCGTAA
GTCGCTTTAAACACTAGTCGGCGTTGCCGTGAATAACTTTTGCACAAGGGATATGATGCTGTCTATCTCGCGTCT
ACCCTTGGAGTCCATGCCATAGGCCTTGATTCGTCAGAGATTGCCGTTGATAAGGCTAGCGCGTGCGTCTCGTTT
CTGAACTTCTTCCCGCAAAAATCAATGATTCTGTTGTGGATAATCACAGTTCCGTGAACGATAGGCCCCTTACCA
AGGGAAAAGCAACATTCGAGCTAGCCGATTTTTTCAAATACTCATCCAATGAAGGTTTTGATCTTGTTTACGATT
ATACGTGAGGAATCTATTTCCACCATGAACTTGAAGTCAAAACAACTATTTTGCTAGGTTTTTCGTTGCTATACC
GCCTTCCCGTCGAAATGAGTGGGGAGCAAAGATGGCGGAACTAATCAAACCTGGAGGATACCTCATAACGCTGAT
CTTCCCAATTGATCCCAAGTCTGATGTGGGACCACCCTTCTATGTCCGTCCAGAGCATTATGACGAGCCGCTTTC
TTCCAACTTCGAGAAAGTCATTGAAAGAATTCCGGAAACCTCTCGGGAAAGTCACAAAGGACGTGAGAGAGTGGC
AGTTTGGAGAAGGAAAGCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail