Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015380
Gene name
Locationscaffold_10:134934..135322
Strand+
Gene length (bp)388
Transcript length (bp)231
Coding sequence length (bp)231
Protein length (aa) 77

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11022 ATP19 ATP synthase subunit K 5.4E-24 2 73

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015380
MSYVIFGRAIKNEHLALGTLLTAIGGSIIMSRGGSKSEAPQTTQQAKASIPIKASSNEEEEFIRKFVEEAEKESN
H*
Coding >AgabiH97|015380
ATGAGCTACGTTATCTTTGGACGCGCCATCAAAAACGAGCATCTCGCTCTAGGTACTCTTCTCACCGCAATCGGT
GGAAGTATTATCATGTCACGCGGTGGTAGCAAGTCTGAAGCACCACAAACAACGCAACAGGCGAAAGCCTCTATT
CCTATTAAAGCCAGTTCAAATGAGGAAGAGGAATTCATCCGAAAGTTCGTTGAGGAAGCCGAGAAAGAGAGCAAC
CACTGA
Transcript >AgabiH97|015380
ATGAGCTACGTTATCTTTGGACGCGCCATCAAAAACGAGCATCTCGCTCTAGGTACTCTTCTCACCGCAATCGGT
GGAAGTATTATCATGTCACGCGGTGGTAGCAAGTCTGAAGCACCACAAACAACGCAACAGGCGAAAGCCTCTATT
CCTATTAAAGCCAGTTCAAATGAGGAAGAGGAATTCATCCGAAAGTTCGTTGAGGAAGCCGAGAAAGAGAGCAAC
CACTGA
Gene >AgabiH97|015380
ATGAGCTAGTGAGCCCTTGTCTTAGGGCATATTGAAATTATCACAGCTGATACAGAGTTCTAGCGTTATCTTTGG
ACGCGCCATCAAAAACGAGCATCTCGCTCTAGGTACTCTTCTCACCGCAATCGGTGGAAGTATTATCATGTCACG
CGGTGGTAGCAAGTCTGAAGCACCACAAACAACGCAACAGGCGAAAGCCTCTATTCCTATTAAAGCCAGTTCAAA
GTACGTTCCTCTCTCTATACTCTTGCGGCCGAGTCTGACCAGACCTCCAGTGAGGAAGAGGAATTGTGAGTGACT
TGTCAAAGAAACTCGTCTACTGTGTACTCATACCATTTCCAGCATCCGAAAGTTCGTTGAGGAAGCCGAGAAAGA
GAGCAACCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail