Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015360
Gene name
Locationscaffold_10:130677..131515
Strand+
Gene length (bp)838
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 130 152 22
3 157 179 22
4 192 214 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015360
MRSFAAIATIATAAFAAVASALPALPGATNGVTDAVIPKEAAVPAYSVHHEHSVVQIIVDLTAKVQPLCDELTAS
ISGDVEVSAAVDISLDILGEIKGFIATAKADIQAAIDVNADLLVLNGETLAVKAVAEIVATLVIAVTTVLGLVVR
VCASANVAVLVKLVADIGIELAGIISLVVRICADLVIVVKPLITVVANVIINLDLKALIQVLVLQGGSHY*
Coding >AgabiH97|015360
ATGCGCTCTTTCGCCGCCATCGCCACCATCGCCACTGCTGCCTTCGCGGCTGTTGCTTCTGCTCTCCCCGCCCTT
CCGGGTGCTACGAACGGAGTGACTGATGCAGTCATTCCTAAAGAGGCTGCAGTCCCAGCGTACTCTGTACATCAC
GAGCACTCTGTCGTTCAGATCATTGTTGATCTAACTGCCAAGGTTCAGCCCCTCTGCGACGAGCTGACCGCATCC
ATCTCTGGCGATGTTGAGGTTTCTGCCGCTGTTGATATTTCTCTTGATATCCTTGGAGAGATCAAAGGGTTCATT
GCTACTGCTAAGGCCGATATTCAGGCCGCTATTGACGTGAATGCTGACCTCCTCGTTCTCAATGGAGAGACTCTC
GCTGTCAAGGCTGTCGCTGAAATTGTTGCTACCCTCGTTATTGCTGTCACTACTGTCCTCGGTCTCGTCGTTAGA
GTTTGCGCTTCGGCCAACGTTGCTGTCCTTGTCAAGCTTGTTGCTGACATTGGTATCGAACTTGCCGGTATCATC
TCTCTCGTCGTTCGGATCTGCGCCGACTTGGTCATTGTCGTCAAGCCTCTCATCACCGTTGTTGCTAACGTCATC
ATCAACCTCGATTTGAAGGCTCTTATCCAAGTCTTGGTTCTCCAGGGCGGTTCTCACTACTAG
Transcript >AgabiH97|015360
ATGCGCTCTTTCGCCGCCATCGCCACCATCGCCACTGCTGCCTTCGCGGCTGTTGCTTCTGCTCTCCCCGCCCTT
CCGGGTGCTACGAACGGAGTGACTGATGCAGTCATTCCTAAAGAGGCTGCAGTCCCAGCGTACTCTGTACATCAC
GAGCACTCTGTCGTTCAGATCATTGTTGATCTAACTGCCAAGGTTCAGCCCCTCTGCGACGAGCTGACCGCATCC
ATCTCTGGCGATGTTGAGGTTTCTGCCGCTGTTGATATTTCTCTTGATATCCTTGGAGAGATCAAAGGGTTCATT
GCTACTGCTAAGGCCGATATTCAGGCCGCTATTGACGTGAATGCTGACCTCCTCGTTCTCAATGGAGAGACTCTC
GCTGTCAAGGCTGTCGCTGAAATTGTTGCTACCCTCGTTATTGCTGTCACTACTGTCCTCGGTCTCGTCGTTAGA
GTTTGCGCTTCGGCCAACGTTGCTGTCCTTGTCAAGCTTGTTGCTGACATTGGTATCGAACTTGCCGGTATCATC
TCTCTCGTCGTTCGGATCTGCGCCGACTTGGTCATTGTCGTCAAGCCTCTCATCACCGTTGTTGCTAACGTCATC
ATCAACCTCGATTTGAAGGCTCTTATCCAAGTCTTGGTTCTCCAGGGCGGTTCTCACTACTAG
Gene >AgabiH97|015360
ATGCGCTCTTTCGCCGCCATCGCCACCATCGCCACTGCTGCCTTCGCGGCTGTTGCTTCTGCTCTCCCCGCCCTT
CCGGGTGCTACGAACGGAGTGACTGATGCAGTCATTCCTAAAGTAAGACCATTTTAATATCTTTGGATGTTCGTC
GTACTGACTTTGCATCATAGGAGGCTGCAGTCCCAGCGTACTCTGTACATCACGAGCACTCTGTCGTTCAGATCA
TTGTTGATCTAACTGCCAAGGTTCAGCCCCTCTGCGACGAGCTGAGTAAGTTTTGTACTAGTCATGATCATGATC
GGCGTTCACAGCTGATTTTGTTCCGCCTATCTTTGCAGCCGCATCCATCTCTGGCGATGTTGAGGTTTCTGCCGC
TGTTGATATTTCTCTTGATATCCTTGGAGAGATCAAAGGGTTCATTGCTACTGCTAAGGCCGATATTCAGGCCGC
TATTGACGTGAATGCTGACCTCCTCGTTCTCAATGGAGAGACTCTCGCTGTCAAGGCTGTCGCTGAAATTGTTGC
TACCCTCGTTATTGTACGTTTTCCTTTCCTACGCTCATTTTGGGTTTGTCTCATCCACTTTCTATAGGCTGTCAC
TACTGTCCTCGGTCTCGTCGTTAGAGTTTGCGCTTCGGCCAACGTTGCTGTCCTTGTCAAGCTTGTTGCTGACAT
TGGTATCGAACTTGCCGGTATCATCTCTCTCGTCGTTCGGATCTGCGCCGACTTGGTCATTGTCGTCAAGCCTCT
CATCACCGTTGTTGCTAACGTCATCATCAACCTCGATTTGAAGGCTCTTATCCAAGTCTTGGTTCTCCAGGGCGG
TTCTCACTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail