Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|015180
Gene name
Locationscaffold_10:80692..82184
Strand-
Gene length (bp)1492
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 5.2E-19 239 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38165|RTG3_YEAST Retrograde regulation protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTG3 PE=1 SV=2 232 342 2.0E-10
sp|O75030|MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens GN=MITF PE=1 SV=2 203 353 1.0E-08
sp|Q05B92|TFE3_BOVIN Transcription factor E3 OS=Bos taurus GN=TFE3 PE=2 SV=1 194 350 4.0E-08
sp|Q08874|MITF_MOUSE Microphthalmia-associated transcription factor OS=Mus musculus GN=Mitf PE=1 SV=3 203 353 5.0E-08
sp|P19532|TFE3_HUMAN Transcription factor E3 OS=Homo sapiens GN=TFE3 PE=1 SV=4 213 350 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38165|RTG3_YEAST Retrograde regulation protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTG3 PE=1 SV=2 232 342 2.0E-10
sp|O75030|MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens GN=MITF PE=1 SV=2 203 353 1.0E-08
sp|Q05B92|TFE3_BOVIN Transcription factor E3 OS=Bos taurus GN=TFE3 PE=2 SV=1 194 350 4.0E-08
sp|Q08874|MITF_MOUSE Microphthalmia-associated transcription factor OS=Mus musculus GN=Mitf PE=1 SV=3 203 353 5.0E-08
sp|P19532|TFE3_HUMAN Transcription factor E3 OS=Homo sapiens GN=TFE3 PE=1 SV=4 213 350 2.0E-07
sp|Q64092|TFE3_MOUSE Transcription factor E3 OS=Mus musculus GN=Tfe3 PE=1 SV=2 213 350 2.0E-07
sp|O88368|MITF_RAT Microphthalmia-associated transcription factor (Fragment) OS=Rattus norvegicus GN=Mitf PE=2 SV=1 230 353 1.0E-06
sp|Q07957|USF1_XENBO Upstream stimulatory factor 1 OS=Xenopus borealis GN=usf1 PE=2 SV=1 238 332 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5219 0.935 0.0139 0.0249 0.1387 0.0002 0.0595 0.1058 0.0374 0.0099

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup3379
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|015180
Agaricus bisporus var bisporus H97 AgabiH97|015180 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|177_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|015180
MAFFSENMHGGFDAFRKFAAPDDFDDDMAALTGYPPRSTHNIFDISLQSHEPFTSSMRYEPHPFALNRHSPSRSR
SRSRPPSAPRPTRARRGNSVSSTSSPPPARPQAILIPGTHSHHRLAASLGGGNAVGSQAWFMNSHSSPSDFSLPT
PDSMHSHHHNYTPFSLNSPTDMHLPPLSHHPIPQSVPKDPIGPNGTIINGINGLGINMSSPSSPPQSLTVVQSSA
EKQAAIANEKRRRRRESHNAVERRRRDNINEKISELATLIPECMLDVGANGPNLDDPLLSPISPIDGSNLILKKE
DQELSTSSPANETGIVKANKGMILRKSVEYIRYLQQLVTAQGARNRELESELKMYRSSGTGSDVAESESSHHMVL
ASESTTANTGSFNGFTLPPTHEDDELMVEEGLHHHQHHHHHHHHHNPYRQQEDDMSSPEGSGMSNEHENGDSLER
GRTRDVARRTVEDMGLVSTTTTTTTTMES*
Coding >AgabiH97|015180
ATGGCGTTCTTTTCTGAAAACATGCACGGCGGATTCGATGCCTTTCGCAAGTTTGCTGCCCCAGACGACTTTGAC
GACGACATGGCCGCGTTGACCGGATATCCTCCTCGCAGCACCCACAACATCTTTGACATCTCTCTCCAATCCCAC
GAGCCATTCACGTCGTCCATGCGCTACGAGCCTCATCCCTTTGCGCTCAACAGGCACTCTCCTTCTCGTTCTCGC
TCCCGGTCTCGTCCTCCTTCTGCCCCTCGTCCCACCCGCGCACGCCGCGGCAACAGCGTCAGCAGCACCTCCTCT
CCACCCCCCGCACGCCCCCAGGCCATCCTCATCCCAGGCACGCACTCCCACCACCGTCTCGCTGCCAGTCTCGGC
GGCGGAAATGCTGTGGGCAGCCAGGCCTGGTTCATGAACTCCCACTCTTCCCCTTCCGACTTTTCTCTCCCCACC
CCAGACTCGATGCACTCGCACCACCACAACTACACCCCCTTTTCCCTCAACTCTCCTACCGATATGCACCTCCCT
CCCCTCTCCCACCACCCCATCCCCCAGAGCGTCCCCAAAGACCCCATCGGCCCCAATGGCACCATCATCAACGGC
ATCAACGGCCTCGGTATCAACATGTCCTCCCCCTCTTCCCCACCCCAAAGTCTCACCGTCGTCCAGTCTTCTGCC
GAAAAACAAGCGGCGATAGCCAACGAAAAACGACGTAGGCGACGTGAATCCCACAATGCTGTCGAAAGACGCAGA
AGAGACAACATCAACGAAAAGATCTCTGAACTGGCTACTCTCATCCCTGAATGCATGCTCGATGTCGGTGCAAAT
GGCCCCAATCTGGATGATCCGCTTTTATCGCCTATATCCCCTATCGATGGTTCAAACCTCATCTTGAAAAAAGAA
GACCAAGAACTCTCTACTTCCTCTCCCGCCAACGAAACTGGTATCGTCAAAGCCAACAAAGGCATGATCCTCAGA
AAAAGTGTCGAATATATTCGGTATCTACAACAATTGGTCACCGCCCAAGGAGCTAGAAATCGTGAATTGGAATCG
GAATTGAAGATGTATAGGTCGTCTGGTACGGGGTCGGATGTGGCTGAATCGGAATCGTCGCATCATATGGTGCTT
GCATCCGAGTCAACTACTGCGAATACGGGATCGTTTAATGGGTTTACGTTACCACCGACACATGAAGATGATGAA
TTGATGGTGGAAGAAGGACTTCATCATCATCAACATCACCATCATCATCATCATCATCATAATCCTTATCGCCAA
CAGGAAGACGACATGAGTAGCCCTGAAGGAAGTGGGATGAGTAACGAACATGAGAATGGGGATTCTTTGGAGAGG
GGGAGGACGAGAGATGTCGCGAGACGAACTGTGGAGGATATGGGTTTGGTATCGACGACGACGACGACGACGACG
ACTATGGAGTCATGA
Transcript >AgabiH97|015180
ATGGCGTTCTTTTCTGAAAACATGCACGGCGGATTCGATGCCTTTCGCAAGTTTGCTGCCCCAGACGACTTTGAC
GACGACATGGCCGCGTTGACCGGATATCCTCCTCGCAGCACCCACAACATCTTTGACATCTCTCTCCAATCCCAC
GAGCCATTCACGTCGTCCATGCGCTACGAGCCTCATCCCTTTGCGCTCAACAGGCACTCTCCTTCTCGTTCTCGC
TCCCGGTCTCGTCCTCCTTCTGCCCCTCGTCCCACCCGCGCACGCCGCGGCAACAGCGTCAGCAGCACCTCCTCT
CCACCCCCCGCACGCCCCCAGGCCATCCTCATCCCAGGCACGCACTCCCACCACCGTCTCGCTGCCAGTCTCGGC
GGCGGAAATGCTGTGGGCAGCCAGGCCTGGTTCATGAACTCCCACTCTTCCCCTTCCGACTTTTCTCTCCCCACC
CCAGACTCGATGCACTCGCACCACCACAACTACACCCCCTTTTCCCTCAACTCTCCTACCGATATGCACCTCCCT
CCCCTCTCCCACCACCCCATCCCCCAGAGCGTCCCCAAAGACCCCATCGGCCCCAATGGCACCATCATCAACGGC
ATCAACGGCCTCGGTATCAACATGTCCTCCCCCTCTTCCCCACCCCAAAGTCTCACCGTCGTCCAGTCTTCTGCC
GAAAAACAAGCGGCGATAGCCAACGAAAAACGACGTAGGCGACGTGAATCCCACAATGCTGTCGAAAGACGCAGA
AGAGACAACATCAACGAAAAGATCTCTGAACTGGCTACTCTCATCCCTGAATGCATGCTCGATGTCGGTGCAAAT
GGCCCCAATCTGGATGATCCGCTTTTATCGCCTATATCCCCTATCGATGGTTCAAACCTCATCTTGAAAAAAGAA
GACCAAGAACTCTCTACTTCCTCTCCCGCCAACGAAACTGGTATCGTCAAAGCCAACAAAGGCATGATCCTCAGA
AAAAGTGTCGAATATATTCGGTATCTACAACAATTGGTCACCGCCCAAGGAGCTAGAAATCGTGAATTGGAATCG
GAATTGAAGATGTATAGGTCGTCTGGTACGGGGTCGGATGTGGCTGAATCGGAATCGTCGCATCATATGGTGCTT
GCATCCGAGTCAACTACTGCGAATACGGGATCGTTTAATGGGTTTACGTTACCACCGACACATGAAGATGATGAA
TTGATGGTGGAAGAAGGACTTCATCATCATCAACATCACCATCATCATCATCATCATCATAATCCTTATCGCCAA
CAGGAAGACGACATGAGTAGCCCTGAAGGAAGTGGGATGAGTAACGAACATGAGAATGGGGATTCTTTGGAGAGG
GGGAGGACGAGAGATGTCGCGAGACGAACTGTGGAGGATATGGGTTTGGTATCGACGACGACGACGACGACGACG
ACTATGGAGTCATGA
Gene >AgabiH97|015180
ATGGCGTTCTTTTCTGAAAACATGCACGGCGGATTCGATGCCTTTCGCAAGTTTGCTGCCCCAGACGACTTTGAC
GACGACATGGCCGCGTTGACCGGATATCCTCCTCGCAGCACCCACAACATCTTTGACATCTCTCTCCAATCCCAC
GAGCCATTCACGTCGTCCATGCGCTACGAGCCTCATCCCTTTGCGCTCAACAGGCACTCTCCTTCTCGTTCTCGC
TCCCGGTCTCGTCCTCCTTCTGCCCCTCGTCCCACCCGCGCACGCCGCGGCAACAGCGTCAGCAGCACCTCCTCT
CCACCCCCCGCACGCCCCCAGGCCATCCTCATCCCAGGCACGCACTCCCACCACCGTCTCGCTGCCAGTCTCGGC
GGCGGAAATGCTGTGGGCAGCCAGGCCTGGTTCATGAACTCCCACTCTTCCCCTTCCGACTTTTCTCTCCCCACC
CCAGACTCGATGCACTCGCACCACCACAACTACACCCCCTTTTCCCTCAACTCTCCTACCGATATGCACCTCCCT
CCCCTCTCCCACCACCCCATCCCCCAGAGCGTCCCCAAAGACCCCATCGGCCCCAATGGCACCATCATCAACGGC
ATCAACGGCCTCGGTATCAACATGTCCTCCCCCTCTTCCCCACCCCAAAGTCTCACCGTCGTCCAGTCTTCTGCC
GAAAAACAAGCGGCGATAGCCAACGAAAAACGACGTAGGCGACGTGAATCCCACAATGCTGTCGAAAGACGCAGA
AGAGACAACATCAACGAAAAGATCTCTGAACTGGCTACTCTCATCCCTGAATGCATGCTCGATGTCGGCAAGTTC
TCCTCGTTTCTCATCTTGTCATCACCTCTAACGCCTACACACAGGTGCAAATGGCCCCAATCTGGATGATCCGCT
TTTATCGCCTATATCCCCTATCGATGGTTCAAACCTCATCTTGAAAAAAGAAGACCAAGAACTCTCTACTTCCTC
TCCCGCCAACGAAACTGGTATCGTCAAAGCCAACAAAGGCATGATCCTCAGAAAAAGTGTCGAATATATTCGGTA
TCTACAACAATTGGTCACCGCCCAAGGAGCTAGAAATCGTGAATTGGAATCGGAATTGAAGATGTATAGGTCGTC
TGGTACGGGGTCGGATGTGGCTGAATCGGAATCGTCGCATCATATGGTGCTTGCATCCGAGTCAACTACTGCGAA
TACGGGATCGTTTAATGGGTTTACGTTACCACCGACACATGAAGATGATGAATTGATGGTGGAAGAAGGACTTCA
TCATCATCAACATCACCATCATCATCATCATCATCATAATCCTTATCGCCAACAGGAAGACGACATGAGTAGCCC
TGAAGGAAGTGGGATGAGTAACGAACATGAGAATGGGGATTCTTTGGAGAGGGGGAGGACGAGAGATGTCGCGAG
ACGAACTGTGGAGGATATGGGTTTGGTATCGACGACGACGACGACGACGACGACTATGGAGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail