Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014820
Gene name
Locationscaffold_1:3532421..3534277
Strand-
Gene length (bp)1856
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.5E-16 73 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 25 317 9.0E-37
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 29 324 1.0E-32
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 74 233 5.0E-09
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 95 271 1.0E-08
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 147 236 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 25 317 9.0E-37
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 29 324 1.0E-32
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 74 233 5.0E-09
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 95 271 1.0E-08
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 147 236 2.0E-08
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 98 228 5.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 74 254 1.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 169 278 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 12.06 5.77 18.35
Initials Initials knots 29.03 16.59 41.47
Pileal_Stipeal_center Stage I stipe center 26.66 15.05 38.27
Pileal_Stipeal_shell Stage I stipe shell 24.53 13.70 35.36
DIF_stipe_center Stage II stipe center 35.95 20.98 50.91
DIF_stipe_shell Stage II stipe shell 23.81 13.30 34.32
DIF_stipe_skin Stage II stipe skin 20.58 11.29 29.86
DIF_cap_skin Stage II cap skin 21.91 12.15 31.66
DIF_cap_tissue Stage II cap tissue 28.46 16.23 40.69
DIF_gill_tissue Stage II gill tissue 31.34 18.02 44.66
YFB_stipe_center Young fruiting body stipe center 17.49 9.43 25.55
YFB_stipe_shell Young fruiting body stipe shell 17.47 9.41 25.54
YFB_stipe_skin Young fruiting body stipe skin 19.87 10.89 28.85
YFB_cap_skin Young fruiting body cap skin 20.04 10.99 29.09
YFB_cap_tissue Young fruiting body cap tissue 48.50 27.93 69.07
YFB_gill_tissue Young fruiting body gill tissue 25.11 14.02 36.20
YFB_veil Young fruiting body veil 24.70 13.89 35.51

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.002525 yes
Casing YFB_stipe_center 0.347228 no
Casing YFB_stipe_shell 0.346962 no
Casing YFB_stipe_skin 0.154787 no
Casing YFB_cap_skin 0.154113 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.024444 yes
Casing YFB_veil 0.030610 yes
Casing Initials 0.004928 yes
Casing Pileal_Stipeal_center 0.012880 yes
Casing Pileal_Stipeal_shell 0.029408 yes
Casing DIF_stipe_center 0.001140 yes
Casing DIF_stipe_shell 0.040279 yes
Casing DIF_stipe_skin 0.120821 no
Casing DIF_cap_skin 0.075908 no
Casing DIF_cap_tissue 0.006742 yes
DIF_gill_tissue YFB_stipe_center 0.054575 no
DIF_gill_tissue YFB_stipe_shell 0.052346 no
DIF_gill_tissue YFB_stipe_skin 0.138008 no
DIF_gill_tissue YFB_cap_skin 0.154525 no
DIF_gill_tissue YFB_cap_tissue 0.145002 no
DIF_gill_tissue YFB_gill_tissue 0.576502 no
DIF_gill_tissue YFB_veil 0.529461 no
YFB_stipe_center YFB_stipe_shell 0.997883 no
YFB_stipe_center YFB_stipe_skin 0.800882 no
YFB_stipe_center YFB_cap_skin 0.784832 no
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.306336 no
YFB_stipe_center YFB_veil 0.326217 no
YFB_stipe_shell YFB_stipe_skin 0.797713 no
YFB_stipe_shell YFB_cap_skin 0.780611 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.303082 no
YFB_stipe_shell YFB_veil 0.322969 no
YFB_stipe_skin YFB_cap_skin 0.987690 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.560654 no
YFB_stipe_skin YFB_veil 0.591550 no
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.579041 no
YFB_cap_skin YFB_veil 0.610783 no
YFB_cap_tissue YFB_gill_tissue 0.022111 yes
YFB_cap_tissue YFB_veil 0.016386 yes
YFB_gill_tissue YFB_veil 0.978438 no
Initials DIF_gill_tissue 0.885120 no
Initials YFB_stipe_center 0.107449 no
Initials YFB_stipe_shell 0.102511 no
Initials YFB_stipe_skin 0.245434 no
Initials YFB_cap_skin 0.265754 no
Initials YFB_cap_tissue 0.072685 no
Initials YFB_gill_tissue 0.751698 no
Initials YFB_veil 0.712557 no
Initials Pileal_Stipeal_center 0.870876 no
Initials Pileal_Stipeal_shell 0.697352 no
Initials DIF_stipe_center 0.581346 no
Initials DIF_stipe_shell 0.627424 no
Initials DIF_stipe_skin 0.310012 no
Initials DIF_cap_skin 0.441641 no
Initials DIF_cap_tissue 0.972599 no
Pileal_Stipeal_center DIF_gill_tissue 0.710074 no
Pileal_Stipeal_center YFB_stipe_center 0.207523 no
Pileal_Stipeal_center YFB_stipe_shell 0.203999 no
Pileal_Stipeal_center YFB_stipe_skin 0.419706 no
Pileal_Stipeal_center YFB_cap_skin 0.443846 no
Pileal_Stipeal_center YFB_cap_tissue 0.034604 yes
Pileal_Stipeal_center YFB_gill_tissue 0.916575 no
Pileal_Stipeal_center YFB_veil 0.888180 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.874488 no
Pileal_Stipeal_center DIF_stipe_center 0.391346 no
Pileal_Stipeal_center DIF_stipe_shell 0.817201 no
Pileal_Stipeal_center DIF_stipe_skin 0.499498 no
Pileal_Stipeal_center DIF_cap_skin 0.642570 no
Pileal_Stipeal_center DIF_cap_tissue 0.904203 no
Pileal_Stipeal_shell DIF_gill_tissue 0.517429 no
Pileal_Stipeal_shell YFB_stipe_center 0.342918 no
Pileal_Stipeal_shell YFB_stipe_shell 0.335330 no
Pileal_Stipeal_shell YFB_stipe_skin 0.610783 no
Pileal_Stipeal_shell YFB_cap_skin 0.629263 no
Pileal_Stipeal_shell YFB_cap_tissue 0.009446 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.969052 no
Pileal_Stipeal_shell YFB_veil 0.989747 no
Pileal_Stipeal_shell DIF_stipe_center 0.226043 no
Pileal_Stipeal_shell DIF_stipe_shell 0.959446 no
Pileal_Stipeal_shell DIF_stipe_skin 0.690086 no
Pileal_Stipeal_shell DIF_cap_skin 0.822198 no
Pileal_Stipeal_shell DIF_cap_tissue 0.743110 no
DIF_stipe_center DIF_gill_tissue 0.764468 no
DIF_stipe_center YFB_stipe_center 0.011968 yes
DIF_stipe_center YFB_stipe_shell 0.011659 yes
DIF_stipe_center YFB_stipe_skin 0.040501 yes
DIF_stipe_center YFB_cap_skin 0.048626 yes
DIF_stipe_center YFB_cap_tissue 0.385133 no
DIF_stipe_center YFB_gill_tissue 0.285239 no
DIF_stipe_center YFB_veil 0.244699 no
DIF_stipe_center DIF_stipe_shell 0.182683 no
DIF_stipe_center DIF_stipe_skin 0.051115 no
DIF_stipe_center DIF_cap_skin 0.100086 no
DIF_stipe_center DIF_cap_tissue 0.536769 no
DIF_stipe_shell DIF_gill_tissue 0.444422 no
DIF_stipe_shell YFB_stipe_center 0.398145 no
DIF_stipe_shell YFB_stipe_shell 0.390956 no
DIF_stipe_shell YFB_stipe_skin 0.677355 no
DIF_stipe_shell YFB_cap_skin 0.696797 no
DIF_stipe_shell YFB_cap_tissue 0.008121 yes
DIF_stipe_shell YFB_gill_tissue 0.926864 no
DIF_stipe_shell YFB_veil 0.950430 no
DIF_stipe_shell DIF_stipe_skin 0.754404 no
DIF_stipe_shell DIF_cap_skin 0.876695 no
DIF_stipe_shell DIF_cap_tissue 0.676146 no
DIF_stipe_skin DIF_gill_tissue 0.186682 no
DIF_stipe_skin YFB_stipe_center 0.727377 no
DIF_stipe_skin YFB_stipe_shell 0.722558 no
DIF_stipe_skin YFB_stipe_skin 0.953410 no
DIF_stipe_skin YFB_cap_skin 0.964566 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.642998 no
DIF_stipe_skin YFB_veil 0.672983 no
DIF_stipe_skin DIF_cap_skin 0.913295 no
DIF_stipe_skin DIF_cap_tissue 0.347054 no
DIF_cap_skin DIF_gill_tissue 0.297401 no
DIF_cap_skin YFB_stipe_center 0.593909 no
DIF_cap_skin YFB_stipe_shell 0.592819 no
DIF_cap_skin YFB_stipe_skin 0.854052 no
DIF_cap_skin YFB_cap_skin 0.866582 no
DIF_cap_skin YFB_cap_tissue 0.004548 yes
DIF_cap_skin YFB_gill_tissue 0.779787 no
DIF_cap_skin YFB_veil 0.811140 no
DIF_cap_skin DIF_cap_tissue 0.489780 no
DIF_cap_tissue DIF_gill_tissue 0.847924 no
DIF_cap_tissue YFB_stipe_center 0.117477 no
DIF_cap_tissue YFB_stipe_shell 0.113027 no
DIF_cap_tissue YFB_stipe_skin 0.271748 no
DIF_cap_tissue YFB_cap_skin 0.295910 no
DIF_cap_tissue YFB_cap_tissue 0.053765 no
DIF_cap_tissue YFB_gill_tissue 0.793435 no
DIF_cap_tissue YFB_veil 0.756270 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014820
MLLTRSLESLAAISLVSGVMADSVGSSGHQGAAGACALLQQKVPHIVHFPGTLEYLTNIDHYEEVATQDSACGVT
PKTVEDVRIIIRTVGRDDVRSPFAIKSGGHALNPGFSSTLGVQISLQNFLDFEYDSKAQTVRLGSAWTWDAVYEK
LQPENVTVVGARISGVGMGALFGGGFSWYTNQHGLAVDNVIAFDLVLPNGTYVNVKQNSHPDLYFGLRGGLNNFG
IVTGATLRTWPSGRIWGGNIEYSIYHKDQVIKAVEEFSMNNKDEKAQLEATYTVTSKRAFWQVLFFYDAPVASPI
PFRRFLSIPSTKDTTKITTHSQLVKDSKSSPVIGSYFHTVPIIHYTARILDVVEKTINASYARSLADERSAGVFY
WIAEPFFNHYSHISYPSAFPHSISNPTTPSCFWFNYTSPRDVEYFRQLIKDAGTEVQKAVVQEGQGHWDDVKYPN
YAVKGTAVEEVYGKSLDRMRALKARIDRKDVMGLQGEGFLI*
Coding >AgabiH97|014820
ATGCTCCTTACTCGCTCATTGGAGTCGCTAGCTGCTATCTCGCTTGTATCTGGTGTGATGGCAGATTCTGTGGGT
TCGTCCGGTCATCAGGGCGCTGCTGGAGCCTGCGCATTACTACAGCAAAAGGTCCCTCATATTGTCCATTTCCCA
GGTACTCTAGAGTATCTAACGAATATAGATCACTATGAAGAAGTGGCAACTCAGGACTCGGCATGTGGAGTCACG
CCGAAGACGGTTGAAGATGTTCGAATTATCATAAGAACTGTTGGTAGGGATGATGTCCGTTCTCCGTTCGCTATC
AAATCTGGTGGTCATGCATTGAATCCCGGATTTTCGTCTACACTTGGCGTTCAAATTTCCTTGCAGAATTTCCTT
GATTTTGAATATGATAGCAAGGCCCAGACAGTTAGGCTAGGGTCTGCTTGGACTTGGGACGCGGTATATGAAAAA
CTCCAACCAGAGAACGTTACAGTTGTAGGAGCGAGAATATCTGGAGTTGGAATGGGCGCGCTCTTTGGCGGCGGA
TTTTCCTGGTATACTAATCAGCATGGGTTAGCTGTGGACAACGTCATCGCATTCGATCTCGTGTTACCAAATGGG
ACTTATGTCAATGTGAAACAAAATTCTCATCCTGATTTGTATTTTGGACTACGAGGTGGTCTTAATAATTTTGGA
ATTGTCACGGGGGCTACTCTTAGAACATGGCCCTCGGGTCGTATCTGGGGAGGAAATATCGAGTACTCGATTTAT
CACAAAGATCAGGTTATCAAAGCTGTGGAAGAATTCAGTATGAACAATAAAGATGAGAAAGCCCAATTGGAAGCT
ACGTACACGGTCACCAGCAAGAGAGCATTCTGGCAGGTTCTATTCTTCTACGACGCACCGGTCGCGTCACCGATT
CCTTTTAGACGATTTCTCTCCATTCCATCAACCAAGGACACAACTAAGATCACGACCCATAGTCAGCTTGTGAAA
GATAGTAAATCTTCCCCCGTCATTGGGTCTTATTTTCATACGGTACCCATTATCCATTATACCGCTCGTATCCTG
GATGTCGTTGAAAAGACAATTAATGCGTCTTACGCGAGGTCTCTGGCTGATGAACGTTCTGCAGGGGTTTTTTAT
TGGATTGCTGAACCGTTCTTCAACCACTACTCGCATATCAGCTATCCCTCAGCTTTCCCACATTCCATATCCAAT
CCGACGACGCCATCGTGTTTCTGGTTTAACTACACCTCGCCTCGCGATGTTGAATATTTCAGACAGTTGATCAAG
GATGCGGGAACGGAGGTACAGAAAGCTGTTGTGCAGGAAGGACAAGGCCATTGGGATGACGTGAAGTATCCAAAC
TACGCGGTCAAAGGAACGGCTGTGGAAGAAGTATATGGAAAGAGCCTAGATCGCATGAGAGCATTGAAGGCAAGA
ATCGACCGGAAGGATGTCATGGGTTTGCAAGGGGAAGGGTTCCTGATATGA
Transcript >AgabiH97|014820
ATGCTCCTTACTCGCTCATTGGAGTCGCTAGCTGCTATCTCGCTTGTATCTGGTGTGATGGCAGATTCTGTGGGT
TCGTCCGGTCATCAGGGCGCTGCTGGAGCCTGCGCATTACTACAGCAAAAGGTCCCTCATATTGTCCATTTCCCA
GGTACTCTAGAGTATCTAACGAATATAGATCACTATGAAGAAGTGGCAACTCAGGACTCGGCATGTGGAGTCACG
CCGAAGACGGTTGAAGATGTTCGAATTATCATAAGAACTGTTGGTAGGGATGATGTCCGTTCTCCGTTCGCTATC
AAATCTGGTGGTCATGCATTGAATCCCGGATTTTCGTCTACACTTGGCGTTCAAATTTCCTTGCAGAATTTCCTT
GATTTTGAATATGATAGCAAGGCCCAGACAGTTAGGCTAGGGTCTGCTTGGACTTGGGACGCGGTATATGAAAAA
CTCCAACCAGAGAACGTTACAGTTGTAGGAGCGAGAATATCTGGAGTTGGAATGGGCGCGCTCTTTGGCGGCGGA
TTTTCCTGGTATACTAATCAGCATGGGTTAGCTGTGGACAACGTCATCGCATTCGATCTCGTGTTACCAAATGGG
ACTTATGTCAATGTGAAACAAAATTCTCATCCTGATTTGTATTTTGGACTACGAGGTGGTCTTAATAATTTTGGA
ATTGTCACGGGGGCTACTCTTAGAACATGGCCCTCGGGTCGTATCTGGGGAGGAAATATCGAGTACTCGATTTAT
CACAAAGATCAGGTTATCAAAGCTGTGGAAGAATTCAGTATGAACAATAAAGATGAGAAAGCCCAATTGGAAGCT
ACGTACACGGTCACCAGCAAGAGAGCATTCTGGCAGGTTCTATTCTTCTACGACGCACCGGTCGCGTCACCGATT
CCTTTTAGACGATTTCTCTCCATTCCATCAACCAAGGACACAACTAAGATCACGACCCATAGTCAGCTTGTGAAA
GATAGTAAATCTTCCCCCGTCATTGGGTCTTATTTTCATACGGTACCCATTATCCATTATACCGCTCGTATCCTG
GATGTCGTTGAAAAGACAATTAATGCGTCTTACGCGAGGTCTCTGGCTGATGAACGTTCTGCAGGGGTTTTTTAT
TGGATTGCTGAACCGTTCTTCAACCACTACTCGCATATCAGCTATCCCTCAGCTTTCCCACATTCCATATCCAAT
CCGACGACGCCATCGTGTTTCTGGTTTAACTACACCTCGCCTCGCGATGTTGAATATTTCAGACAGTTGATCAAG
GATGCGGGAACGGAGGTACAGAAAGCTGTTGTGCAGGAAGGACAAGGCCATTGGGATGACGTGAAGTATCCAAAC
TACGCGGTCAAAGGAACGGCTGTGGAAGAAGTATATGGAAAGAGCCTAGATCGCATGAGAGCATTGAAGGCAAGA
ATCGACCGGAAGGATGTCATGGGTTTGCAAGGGGAAGGGTTCCTGATATGA
Gene >AgabiH97|014820
ATGCTCCTTACTCGCTCATTGGAGTCGCTAGCTGCTATCTCGCTTGTATCTGGTGTGATGGCAGATTCTGTGGGT
TCGTCCGGTCATCAGGGCGCTGCTGGAGCCTGCGCATTACTACAGCAAAAGGTCCCTCATATTGTCCATTTCCCA
GGTTCGTGTACCACTAATGCTACTATGCTTTACCTTGACAAGTTTGCCTAGGTACTCTAGAGTATCTAACGAATA
TAGATCACTATGAAGAAGTGGCAACTCAGGACTCGGCATGTGGAGTCACGCCGAAGACGGTTGAAGATGTTCGAA
TTATCGTATGTTTTTACTATTCCTTGACGGCTTCTCACTTTGGTTATTTCTAGATAAGAACTGTTGGTAGGGATG
ATGTCCGTTCTCCGTTCGCTGTGTGTCTCTCGCTCTTACTGAATCGGCACTTCCCTTCGACTTATGCGCGGTTTA
GATCAAATCTGGTGGTCATGCATTGAATCCCGGATTTTCGTCTACACTTGGCGTTCAAATTTCCTTGCAGAATTT
CCTTGATTTTGAATATGATAGCAAGGCCCAGACAGTTAGGCTAGGGTCTGCTTGGACTTGGGACGCGGTATATGA
AAAACTCCAACCAGAGAACGTTACAGTTGTAGGAGCGAGAATATCTGGAGTTGGTAAGCTCAATGGATCTGAGGT
CTGTTCCCCTGCTTGGCCACCGGCTGATATACCATGGTGCAGGAATGGGCGCGCTCTTTGGCGGCGGATTTTCCT
GGTATACTAATCAGCATGGGTTAGCTGTGGACAACGTCATCGCATTCGATCTCGTGTTACCAAATGGGACTTATG
TCAATGTGAAACAAAATTCTCATCCTGATTTGTATTTTGGACTACGAGGTGGTCTTAATAATTTTGGAATTGTCA
CGGGGGCTACTCTTAGAACATGGCCCTCGGGTCGTATCTGGGTAAATCTCAAGCTCTCGTCCGCGTGACTAACGC
TGAAGCGCTTGTAGGGAGGAAATATCGAGTACTCGATTTATCACAAAGATCAGGTTATCAAAGCTGTGGAAGAAT
TCAGTATGAACAATAAAGATGAGAAAGCCCAATTGGAAGCTACGTACACGGTCACCAGCAAGAGAGTTTGTTTAG
AGTATTTTCAACGATTTTCGAGATTTTAACATTCAGCATCATCCATAGGCATTCTGGCAGGTTCTATTCTTCTAC
GACGCACCGGTCGCGTCACCGATTCCTTTTAGACGATTTCTCTCCATTCCATCAACCAAGGACACAACTAAGATC
ACGACCCATAGTCAGCTTGTGAAAGATAGTAAATCTTCCCCGTAAGTTTGAACCAATCCACATGACGTGTCCTCT
GATATCACGGGTCATTTTCTAGCGTCATTGGGTCTTATTTTCATACGGTACCCATTATCCATTATACCGCTCGTA
TCCTGGATGTCGTTGAAAAGACAATTAATGCGTCTTACGCGAGGTCTCTGGCTGATGAACGTTCTGCAGGGGTTT
TTTATTGGATTGCTGAACCGTTCTTCAACCACTACTCGCATATCAGCTATCCCTCAGCTTTCCCACATTCCATAT
CCAATCCGACGACGCCATCGTGTTTCTGGTTTAACTACACCTCGCCTCGCGATGTTGAATATTTCAGACAGTTGA
TCAAGGATGCGGGAACGGAGGTACAGAAAGCTGTTGTGCAGGAAGGACAAGGCCATTGGGATGACGTGAAGTATC
CAAACTACGCGGTCAAAGGAACGGCTGTGGAAGAAGTATATGGAAAGAGCCTAGATCGCATGAGAGCATTGAAGG
CAAGAATCGACCGGAAGGATGTCATGGGTTTGCAAGGGGAAGGGTTCCTGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail