Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014500
Gene name
Locationscaffold_1:3465078..3465816
Strand-
Gene length (bp)738
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11 3.2E-71 48 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 5.0E-82
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 5.0E-82
sp|P55332|XYNA_EMENI Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnA PE=1 SV=1 1 224 3.0E-81
sp|Q4WG11|XYNA_ASPFU Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnA PE=1 SV=1 1 224 3.0E-79
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 3.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 5.0E-82
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 5.0E-82
sp|P55332|XYNA_EMENI Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnA PE=1 SV=1 1 224 3.0E-81
sp|Q4WG11|XYNA_ASPFU Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnA PE=1 SV=1 1 224 3.0E-79
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 3.0E-79
sp|A1DJ52|XYNA_NEOFI Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnA PE=3 SV=1 1 224 8.0E-79
sp|Q0CFS3|XYNA_ASPTN Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnA PE=3 SV=1 4 224 4.0E-77
sp|Q0ZHI9|XYNG_VERDA Endo-1,4-beta-xylanase G OS=Verticillium dahliae GN=xynG PE=1 SV=1 1 224 5.0E-76
sp|Q9HGE1|XYN2_HUMGT Endo-1,4-beta-xylanase 2 OS=Humicola grisea var. thermoidea GN=xyn2 PE=1 SV=1 1 224 9.0E-75
sp|P55334|XYN1_HUMIN Endo-1,4-beta-xylanase 1 OS=Humicola insolens GN=XYL1 PE=2 SV=1 1 224 2.0E-74
sp|P55333|XYNB_EMENI Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnB PE=2 SV=2 1 225 8.0E-73
sp|P36217|XYN2_HYPJE Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina GN=xyn2 PE=1 SV=1 4 224 2.0E-72
sp|A1DNU5|XYNB_NEOFI Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnB PE=3 SV=1 1 224 2.0E-72
sp|A1CU59|XYNB_ASPCL Probable endo-1,4-beta-xylanase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnB PE=3 SV=2 1 225 2.0E-72
sp|A1CCU0|XYNA_ASPCL Probable endo-1,4-beta-xylanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnA PE=3 SV=1 25 224 8.0E-72
sp|P48824|XYNB_ASPKW Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=xlnB PE=3 SV=2 5 224 5.0E-71
sp|I1S2K3|XYNA_GIBZE Endo-1,4-beta-xylanase A OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLA PE=1 SV=1 1 224 4.0E-70
sp|P87037|XYNB_ASPOR Probable endo-1,4-beta-xylanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnB PE=1 SV=1 1 224 2.0E-69
sp|B8NJ86|XYNB_ASPFN Probable endo-1,4-beta-xylanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnB PE=3 SV=1 1 224 2.0E-69
sp|Q9HFH0|XYNC_TALFU Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus GN=xynC PE=1 SV=1 4 224 6.0E-69
sp|Q4WLV2|XYNB_ASPFU Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnB PE=3 SV=1 1 224 5.0E-68
sp|B0Y8Q8|XYNB_ASPFC Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnB PE=3 SV=1 1 224 5.0E-68
sp|B5A7N4|XYN2_TRIHA Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum GN=Xyn2 PE=1 SV=1 1 224 3.0E-67
sp|P55330|XYNB_ASPNG Endo-1,4-beta-xylanase B OS=Aspergillus niger GN=xlnB PE=1 SV=1 30 224 5.0E-66
sp|A2Q7I0|XYNB_ASPNC Probable endo-1,4-beta-xylanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnB PE=3 SV=1 30 224 5.0E-66
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 1 225 6.0E-66
sp|I1RII8|XYNB_GIBZE Endo-1,4-beta-xylanase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLB PE=1 SV=1 1 224 3.0E-65
sp|G4NA54|XYN4_MAGO7 Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL4 PE=3 SV=1 40 224 5.0E-65
sp|Q92245|XYN4_MAGGR Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea GN=XYL4 PE=3 SV=2 40 224 5.0E-65
sp|Q2LMP0|XY11A_BOTFU Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana GN=xyn11A PE=2 SV=1 18 225 9.0E-65
sp|A6YAP7|XYN1_LEUGO Endo-1,4-beta-xylanase 1 OS=Leucoagaricus gongylophorus GN=Xyn1 PE=1 SV=1 1 224 6.0E-64
sp|Q2PGY1|XYNA_PENCI Endo-1,4-beta-xylanase A OS=Penicillium citrinum GN=xynA PE=1 SV=1 1 224 1.0E-63
sp|Q06562|XYN1_COCCA Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum GN=XYL1 PE=1 SV=1 32 225 2.0E-63
sp|P48793|XYN_TRIHA Endo-1,4-beta-xylanase OS=Trichoderma harzianum PE=1 SV=1 36 224 1.0E-62
sp|P0CT49|XYN1_MAGO7 Endo-1,4-beta-xylanase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL1 PE=3 SV=1 1 224 7.0E-62
sp|P0CT48|XYN1_MAGGR Endo-1,4-beta-xylanase 1 OS=Magnaporthe grisea GN=XYL1 PE=1 SV=1 1 224 7.0E-62
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 1 224 8.0E-62
sp|B3VSG7|XY11A_BOTFB Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana (strain B05.10) GN=xyn11A PE=1 SV=1 18 225 1.0E-61
sp|D7EZJ3|XYNB_STRSQ Endo-1,4-beta-xylanase B OS=Streptomyces sp. GN=xynBS9 PE=1 SV=1 36 224 3.0E-59
sp|W0HJ53|XYN2_RHIOR Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae GN=xyn2 PE=1 SV=1 1 224 1.0E-58
sp|P26515|XYNB_STRLI Endo-1,4-beta-xylanase B OS=Streptomyces lividans GN=xlnB PE=1 SV=3 38 224 2.0E-58
sp|O74716|XYN1_CLAPU Endo-1,4-beta-xylanase 1 OS=Claviceps purpurea GN=xyl1 PE=2 SV=1 4 225 2.0E-58
sp|P35809|XYNA_SCHCO Endo-1,4-beta-xylanase A OS=Schizophyllum commune GN=XYNA PE=1 SV=1 40 224 4.0E-57
sp|O43097|XYNA_THELA Endo-1,4-beta-xylanase OS=Thermomyces lanuginosus GN=XYNA PE=1 SV=1 32 224 6.0E-57
sp|Q92244|XYN3_MAGGR Endo-1,4-beta-xylanase 3 OS=Magnaporthe grisea GN=XYL3 PE=1 SV=2 15 224 2.0E-56
sp|G4MWS3|XYN3_MAGO7 Endo-1,4-beta-xylanase 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL3 PE=3 SV=1 15 224 2.0E-56
sp|Q8VP72|XY11B_CELJA Endo-1,4-beta-xylanase Xyn11B OS=Cellvibrio japonicus GN=xyn11B PE=1 SV=1 33 224 2.0E-54
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 38 224 1.0E-53
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 31 224 1.0E-52
sp|P81536|XYNA_BYSSP Endo-1,4-beta-xylanase OS=Byssochlamys spectabilis PE=1 SV=1 40 224 8.0E-51
sp|O97402|XYN_PHACE Endo-1,4-beta-xylanase OS=Phaedon cochleariae PE=2 SV=1 31 224 2.0E-50
sp|Q9RI72|XYNC_STRCO Endo-1,4-beta-xylanase C OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xlnC PE=3 SV=1 47 224 1.0E-49
sp|P26220|XYNC_STRLI Endo-1,4-beta-xylanase C OS=Streptomyces lividans GN=xlnC PE=1 SV=1 47 224 8.0E-47
sp|P45705|XYNA_GEOSE Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus GN=xynA PE=3 SV=2 63 224 3.0E-45
sp|P36218|XYN1_HYPJE Endo-1,4-beta-xylanase 1 OS=Hypocrea jecorina GN=xyn1 PE=1 SV=1 1 224 3.0E-44
sp|P18429|XYNA_BACSU Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) GN=xynA PE=1 SV=1 63 224 4.0E-43
sp|Q12562|XYNA_AURPU Endo-1,4-beta-xylanase A OS=Aureobasidium pullulans GN=xynA PE=1 SV=1 62 224 4.0E-43
sp|P55329|XYNA_ASPNG Endo-1,4-beta-xylanase A OS=Aspergillus niger GN=xynA PE=1 SV=1 62 225 6.0E-43
sp|P09850|XYNA_BACCI Endo-1,4-beta-xylanase OS=Bacillus circulans GN=xlnA PE=1 SV=1 63 224 7.0E-43
sp|Q6QJ75|XYN6_ASPNG Endo-1,4-beta-xylanase 6 OS=Aspergillus niger GN=XYN6 PE=1 SV=1 62 225 1.0E-42
sp|P55331|XYNA_ASPTU Endo-1,4-beta-xylanase A OS=Aspergillus tubingensis GN=xynA PE=3 SV=2 62 225 1.0E-42
sp|Q96TR7|XYN1_AURPU Endo-1,4-beta-xylanase 1 OS=Aureobasidium pullulans GN=xynI PE=1 SV=1 62 225 3.0E-42
sp|P55328|XYNA_ASPAW Endo-1,4-beta-xylanase A OS=Aspergillus awamori GN=xynA PE=1 SV=1 62 225 3.0E-42
sp|P33557|XYN3_ASPKW Endo-1,4-beta-xylanase 3 OS=Aspergillus kawachii (strain NBRC 4308) GN=xynC PE=1 SV=2 62 225 3.0E-42
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 64 224 1.0E-39
sp|P00694|XYNA_BACPU Endo-1,4-beta-xylanase A OS=Bacillus pumilus GN=xynA PE=1 SV=2 36 225 5.0E-39
sp|Q12550|XYN4_ASPNG Endo-1,4-beta-xylanase 4 OS=Aspergillus niger GN=XYN4 PE=1 SV=2 62 225 2.0E-37
sp|Q8GJ44|XYNA1_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 94 225 3.0E-37
sp|A2R4D1|XYN5_ASPNC Probable endo-1,4-beta-xylanase 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=XYN5 PE=3 SV=1 4 224 1.0E-36
sp|Q96W72|XYNB_TALPU Endo-1,4-beta-xylanase B OS=Talaromyces purpurogenus GN=xynB PE=1 SV=1 69 224 1.0E-36
sp|P17137|XYNA_CLOSA Endo-1,4-beta-xylanase OS=Clostridium saccharobutylicum GN=xynB PE=3 SV=1 36 222 6.0E-36
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 31 225 2.0E-35
sp|Q12549|XYN5_ASPNG Endo-1,4-beta-xylanase 5 OS=Aspergillus niger GN=XYN5 PE=1 SV=1 4 225 2.0E-35
sp|Q4P0L3|XY11A_USTMA Endo-1,4-beta-xylanase 11A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=XYN11A PE=1 SV=1 27 224 5.0E-35
sp|P33558|XYNA2_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 94 225 3.0E-34
sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens GN=xynA PE=3 SV=1 42 222 2.0E-32
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 10 222 1.0E-28
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 108 223 7.0E-21
sp|A8TGA1|XYS20_NEOPA Endo-1,4-beta-xylanase S20 OS=Neocallimastix patriciarum GN=xynS20 PE=1 SV=1 28 213 2.0E-17
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 1 223 5.0E-17
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 44 224 6.0E-17
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 108 212 4.0E-16
sp|Q9UV68|XYNC_NEOPA Endo-1,4-beta-xylanase C OS=Neocallimastix patriciarum GN=xynC PE=1 SV=1 108 225 4.0E-15
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 108 220 6.0E-14
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 4 203 7.0E-13
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 108 225 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014500
MVSMKSFLTLASAALTAMAMPHFANNTESHLLVPRQTINTPSTGFVDGHFYSLWMQSSTGATMNVQGNSYSLNWQ
TSSQNVVGGIGWNPGSSRVINYSGNFNCAANCYLSIYGWTENPLIEYYIVESYGTFNPGSQAQLLGSVNSDGGTY
NIYHTVRVNQPSIHGTATFDQFWSVRTSHRIGGSVNVGNHFNAWASHGLRLGSHNYQIVASEGFQSSGSSSITVN
*
Coding >AgabiH97|014500
ATGGTCTCTATGAAGTCTTTCCTCACTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGCGGAATTGGCTGGAACCCAGGAAGTAGCAGAGTGATCAACTACAGTGGTAAC
TTCAACTGTGCCGCAAATTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTC
GAATCCTACGGTACCTTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAACTCTGACGGTGGAACCTAC
AACATCTACCACACCGTCCGTGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCATTGGTGGCTCTGTCAACGTCGGCAACCACTTCAATGCATGGGCTAGCCACGGTCTTAGG
TTGGGTTCGCACAACTACCAGATCGTTGCTTCGGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAAT
TAA
Transcript >AgabiH97|014500
ATGGTCTCTATGAAGTCTTTCCTCACTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGCGGAATTGGCTGGAACCCAGGAAGTAGCAGAGTGATCAACTACAGTGGTAAC
TTCAACTGTGCCGCAAATTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTC
GAATCCTACGGTACCTTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAACTCTGACGGTGGAACCTAC
AACATCTACCACACCGTCCGTGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCATTGGTGGCTCTGTCAACGTCGGCAACCACTTCAATGCATGGGCTAGCCACGGTCTTAGG
TTGGGTTCGCACAACTACCAGATCGTTGCTTCGGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAAT
TAA
Gene >AgabiH97|014500
ATGGTCTCTATGAAGTCTTTCCTCACTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGCGGAATTGGCTGGAACCCAGGAAGTAGCAGGTTCGTGATCATGTTCATATGA
ATCTTCACACTGATGGATCTGACGGTTATCGAATCTAGAGTGATCAACTACAGTGGTAACTTCAACTGTGCCGCA
AATTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTCGAATCCTACGGTACC
TTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAACTCTGACGGTGGAACCTACAACATCTACCACACC
GTCCGTGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTCCGCACGTCCCACCGC
ATTGGTGGCTCTGTCAACGTCGGCAACCACTTCAATGCATGGGCTAGCCACGGTCTTAGGTTGGGTTCGCACAAC
TACCAGATCGTTGCTTCGGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail