Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014490
Gene name
Locationscaffold_1:3462670..3463771
Strand+
Gene length (bp)1101
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11 3.5E-71 47 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 5.0E-84
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 5.0E-84
sp|Q0ZHI9|XYNG_VERDA Endo-1,4-beta-xylanase G OS=Verticillium dahliae GN=xynG PE=1 SV=1 1 224 2.0E-82
sp|Q0CFS3|XYNA_ASPTN Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnA PE=3 SV=1 1 224 1.0E-81
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 6.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 5.0E-84
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 5.0E-84
sp|Q0ZHI9|XYNG_VERDA Endo-1,4-beta-xylanase G OS=Verticillium dahliae GN=xynG PE=1 SV=1 1 224 2.0E-82
sp|Q0CFS3|XYNA_ASPTN Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnA PE=3 SV=1 1 224 1.0E-81
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 6.0E-81
sp|Q4WG11|XYNA_ASPFU Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnA PE=1 SV=1 1 224 6.0E-81
sp|P55332|XYNA_EMENI Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnA PE=1 SV=1 1 224 4.0E-80
sp|A1DJ52|XYNA_NEOFI Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnA PE=3 SV=1 1 224 8.0E-80
sp|A1CU59|XYNB_ASPCL Probable endo-1,4-beta-xylanase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnB PE=3 SV=2 1 225 2.0E-78
sp|A1DNU5|XYNB_NEOFI Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnB PE=3 SV=1 1 225 3.0E-78
sp|P55333|XYNB_EMENI Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnB PE=2 SV=2 1 225 1.0E-76
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 1 265 1.0E-76
sp|P48824|XYNB_ASPKW Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=xlnB PE=3 SV=2 5 224 2.0E-75
sp|P87037|XYNB_ASPOR Probable endo-1,4-beta-xylanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnB PE=1 SV=1 1 225 4.0E-75
sp|B8NJ86|XYNB_ASPFN Probable endo-1,4-beta-xylanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnB PE=3 SV=1 1 225 4.0E-75
sp|Q4WLV2|XYNB_ASPFU Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnB PE=3 SV=1 1 225 8.0E-75
sp|B0Y8Q8|XYNB_ASPFC Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnB PE=3 SV=1 1 225 8.0E-75
sp|Q9HFH0|XYNC_TALFU Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus GN=xynC PE=1 SV=1 6 225 2.0E-72
sp|A1CCU0|XYNA_ASPCL Probable endo-1,4-beta-xylanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnA PE=3 SV=1 1 224 7.0E-72
sp|Q9HGE1|XYN2_HUMGT Endo-1,4-beta-xylanase 2 OS=Humicola grisea var. thermoidea GN=xyn2 PE=1 SV=1 1 224 2.0E-71
sp|P55334|XYN1_HUMIN Endo-1,4-beta-xylanase 1 OS=Humicola insolens GN=XYL1 PE=2 SV=1 1 224 4.0E-71
sp|I1S2K3|XYNA_GIBZE Endo-1,4-beta-xylanase A OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLA PE=1 SV=1 1 224 2.0E-70
sp|A2Q7I0|XYNB_ASPNC Probable endo-1,4-beta-xylanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnB PE=3 SV=1 30 224 6.0E-70
sp|P55330|XYNB_ASPNG Endo-1,4-beta-xylanase B OS=Aspergillus niger GN=xlnB PE=1 SV=1 30 224 6.0E-70
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 1 225 2.0E-69
sp|Q2LMP0|XY11A_BOTFU Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana GN=xyn11A PE=2 SV=1 18 225 6.0E-69
sp|P36217|XYN2_HYPJE Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina GN=xyn2 PE=1 SV=1 1 225 2.0E-68
sp|B3VSG7|XY11A_BOTFB Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana (strain B05.10) GN=xyn11A PE=1 SV=1 18 225 1.0E-66
sp|B5A7N4|XYN2_TRIHA Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum GN=Xyn2 PE=1 SV=1 1 225 6.0E-65
sp|W0HJ53|XYN2_RHIOR Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae GN=xyn2 PE=1 SV=1 1 225 3.0E-64
sp|Q2PGY1|XYNA_PENCI Endo-1,4-beta-xylanase A OS=Penicillium citrinum GN=xynA PE=1 SV=1 32 225 7.0E-63
sp|I1RII8|XYNB_GIBZE Endo-1,4-beta-xylanase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLB PE=1 SV=1 1 225 7.0E-63
sp|Q92245|XYN4_MAGGR Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea GN=XYL4 PE=3 SV=2 39 226 2.0E-62
sp|G4NA54|XYN4_MAGO7 Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL4 PE=3 SV=1 39 226 2.0E-62
sp|P0CT49|XYN1_MAGO7 Endo-1,4-beta-xylanase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL1 PE=3 SV=1 1 224 3.0E-62
sp|P0CT48|XYN1_MAGGR Endo-1,4-beta-xylanase 1 OS=Magnaporthe grisea GN=XYL1 PE=1 SV=1 1 224 3.0E-62
sp|A6YAP7|XYN1_LEUGO Endo-1,4-beta-xylanase 1 OS=Leucoagaricus gongylophorus GN=Xyn1 PE=1 SV=1 4 225 2.0E-61
sp|P48793|XYN_TRIHA Endo-1,4-beta-xylanase OS=Trichoderma harzianum PE=1 SV=1 68 225 2.0E-61
sp|P26515|XYNB_STRLI Endo-1,4-beta-xylanase B OS=Streptomyces lividans GN=xlnB PE=1 SV=3 37 224 8.0E-61
sp|D7EZJ3|XYNB_STRSQ Endo-1,4-beta-xylanase B OS=Streptomyces sp. GN=xynBS9 PE=1 SV=1 36 224 1.0E-60
sp|G4MWS3|XYN3_MAGO7 Endo-1,4-beta-xylanase 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL3 PE=3 SV=1 6 224 3.0E-59
sp|Q92244|XYN3_MAGGR Endo-1,4-beta-xylanase 3 OS=Magnaporthe grisea GN=XYL3 PE=1 SV=2 6 224 3.0E-59
sp|Q06562|XYN1_COCCA Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum GN=XYL1 PE=1 SV=1 32 224 2.0E-58
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 38 226 7.0E-58
sp|Q8VP72|XY11B_CELJA Endo-1,4-beta-xylanase Xyn11B OS=Cellvibrio japonicus GN=xyn11B PE=1 SV=1 36 224 1.0E-56
sp|O43097|XYNA_THELA Endo-1,4-beta-xylanase OS=Thermomyces lanuginosus GN=XYNA PE=1 SV=1 1 228 4.0E-56
sp|P35809|XYNA_SCHCO Endo-1,4-beta-xylanase A OS=Schizophyllum commune GN=XYNA PE=1 SV=1 39 225 1.0E-55
sp|O74716|XYN1_CLAPU Endo-1,4-beta-xylanase 1 OS=Claviceps purpurea GN=xyl1 PE=2 SV=1 68 225 1.0E-55
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 36 226 5.0E-55
sp|O97402|XYN_PHACE Endo-1,4-beta-xylanase OS=Phaedon cochleariae PE=2 SV=1 31 225 4.0E-48
sp|P81536|XYNA_BYSSP Endo-1,4-beta-xylanase OS=Byssochlamys spectabilis PE=1 SV=1 39 228 2.0E-47
sp|P55329|XYNA_ASPNG Endo-1,4-beta-xylanase A OS=Aspergillus niger GN=xynA PE=1 SV=1 62 225 3.0E-47
sp|Q9RI72|XYNC_STRCO Endo-1,4-beta-xylanase C OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xlnC PE=3 SV=1 27 225 3.0E-47
sp|P55331|XYNA_ASPTU Endo-1,4-beta-xylanase A OS=Aspergillus tubingensis GN=xynA PE=3 SV=2 62 225 5.0E-47
sp|P33557|XYN3_ASPKW Endo-1,4-beta-xylanase 3 OS=Aspergillus kawachii (strain NBRC 4308) GN=xynC PE=1 SV=2 62 225 1.0E-46
sp|P55328|XYNA_ASPAW Endo-1,4-beta-xylanase A OS=Aspergillus awamori GN=xynA PE=1 SV=1 62 225 1.0E-46
sp|Q6QJ75|XYN6_ASPNG Endo-1,4-beta-xylanase 6 OS=Aspergillus niger GN=XYN6 PE=1 SV=1 62 225 2.0E-46
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 64 265 2.0E-45
sp|P26220|XYNC_STRLI Endo-1,4-beta-xylanase C OS=Streptomyces lividans GN=xlnC PE=1 SV=1 27 225 5.0E-45
sp|P45705|XYNA_GEOSE Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus GN=xynA PE=3 SV=2 68 224 2.0E-43
sp|P36218|XYN1_HYPJE Endo-1,4-beta-xylanase 1 OS=Hypocrea jecorina GN=xyn1 PE=1 SV=1 1 226 3.0E-43
sp|Q96TR7|XYN1_AURPU Endo-1,4-beta-xylanase 1 OS=Aureobasidium pullulans GN=xynI PE=1 SV=1 62 225 5.0E-43
sp|Q12562|XYNA_AURPU Endo-1,4-beta-xylanase A OS=Aureobasidium pullulans GN=xynA PE=1 SV=1 62 225 1.0E-42
sp|Q12550|XYN4_ASPNG Endo-1,4-beta-xylanase 4 OS=Aspergillus niger GN=XYN4 PE=1 SV=2 62 225 4.0E-42
sp|P18429|XYNA_BACSU Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) GN=xynA PE=1 SV=1 68 224 4.0E-42
sp|P09850|XYNA_BACCI Endo-1,4-beta-xylanase OS=Bacillus circulans GN=xlnA PE=1 SV=1 68 224 4.0E-42
sp|A2R4D1|XYN5_ASPNC Probable endo-1,4-beta-xylanase 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=XYN5 PE=3 SV=1 9 225 7.0E-41
sp|Q96W72|XYNB_TALPU Endo-1,4-beta-xylanase B OS=Talaromyces purpurogenus GN=xynB PE=1 SV=1 67 225 9.0E-41
sp|P00694|XYNA_BACPU Endo-1,4-beta-xylanase A OS=Bacillus pumilus GN=xynA PE=1 SV=2 36 222 3.0E-40
sp|Q12549|XYN5_ASPNG Endo-1,4-beta-xylanase 5 OS=Aspergillus niger GN=XYN5 PE=1 SV=1 9 225 8.0E-40
sp|Q8GJ44|XYNA1_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 5 235 1.0E-39
sp|P33558|XYNA2_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 5 235 1.0E-36
sp|P17137|XYNA_CLOSA Endo-1,4-beta-xylanase OS=Clostridium saccharobutylicum GN=xynB PE=3 SV=1 36 222 8.0E-36
sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens GN=xynA PE=3 SV=1 42 230 2.0E-35
sp|Q4P0L3|XY11A_USTMA Endo-1,4-beta-xylanase 11A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=XYN11A PE=1 SV=1 64 225 2.0E-35
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 31 222 5.0E-34
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 5 249 6.0E-32
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 40 226 5.0E-21
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 38 220 2.0E-18
sp|Q9UV68|XYNC_NEOPA Endo-1,4-beta-xylanase C OS=Neocallimastix patriciarum GN=xynC PE=1 SV=1 1 220 2.0E-17
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 40 237 1.0E-16
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 47 224 3.0E-16
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 39 212 3.0E-16
sp|A8TGA1|XYS20_NEOPA Endo-1,4-beta-xylanase S20 OS=Neocallimastix patriciarum GN=xynS20 PE=1 SV=1 35 267 1.0E-15
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 4 203 2.0E-14
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 108 225 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 291.03 106.87 475.18
Initials Initials knots 5.26 2.12 8.41
Pileal_Stipeal_center Stage I stipe center 4.11 1.49 6.73
Pileal_Stipeal_shell Stage I stipe shell 7.60 3.31 11.90
DIF_stipe_center Stage II stipe center 3.52 1.27 5.77
DIF_stipe_shell Stage II stipe shell 4.01 1.45 6.57
DIF_stipe_skin Stage II stipe skin 5.21 2.10 8.32
DIF_cap_skin Stage II cap skin 7.87 3.39 12.34
DIF_cap_tissue Stage II cap tissue 5.08 1.99 8.16
DIF_gill_tissue Stage II gill tissue 5.81 2.32 9.30
YFB_stipe_center Young fruiting body stipe center 2.83 0.96 4.70
YFB_stipe_shell Young fruiting body stipe shell 2.62 0.83 4.41
YFB_stipe_skin Young fruiting body stipe skin 3.87 1.41 6.34
YFB_cap_skin Young fruiting body cap skin 6.36 2.58 10.13
YFB_cap_tissue Young fruiting body cap tissue 4.08 1.47 6.69
YFB_gill_tissue Young fruiting body gill tissue 5.97 2.43 9.51
YFB_veil Young fruiting body veil 9.05 3.93 14.17

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.099595 no
DIF_gill_tissue YFB_stipe_shell 0.073949 no
DIF_gill_tissue YFB_stipe_skin 0.441434 no
DIF_gill_tissue YFB_cap_skin 0.907456 no
DIF_gill_tissue YFB_cap_tissue 0.522033 no
DIF_gill_tissue YFB_gill_tissue 0.974478 no
DIF_gill_tissue YFB_veil 0.345911 no
YFB_stipe_center YFB_stipe_shell 0.928675 no
YFB_stipe_center YFB_stipe_skin 0.606170 no
YFB_stipe_center YFB_cap_skin 0.058347 no
YFB_stipe_center YFB_cap_tissue 0.525077 no
YFB_stipe_center YFB_gill_tissue 0.087251 no
YFB_stipe_center YFB_veil 0.003365 yes
YFB_stipe_shell YFB_stipe_skin 0.509406 no
YFB_stipe_shell YFB_cap_skin 0.046536 yes
YFB_stipe_shell YFB_cap_tissue 0.435155 no
YFB_stipe_shell YFB_gill_tissue 0.064333 no
YFB_stipe_shell YFB_veil 0.002951 yes
YFB_stipe_skin YFB_cap_skin 0.310882 no
YFB_stipe_skin YFB_cap_tissue 0.952304 no
YFB_stipe_skin YFB_gill_tissue 0.389862 no
YFB_stipe_skin YFB_veil 0.036683 yes
YFB_cap_skin YFB_cap_tissue 0.382602 no
YFB_cap_skin YFB_gill_tissue 0.938065 no
YFB_cap_skin YFB_veil 0.487508 no
YFB_cap_tissue YFB_gill_tissue 0.469299 no
YFB_cap_tissue YFB_veil 0.052547 no
YFB_gill_tissue YFB_veil 0.387051 no
Initials DIF_gill_tissue 0.896433 no
Initials YFB_stipe_center 0.172433 no
Initials YFB_stipe_shell 0.124995 no
Initials YFB_stipe_skin 0.598225 no
Initials YFB_cap_skin 0.772751 no
Initials YFB_cap_tissue 0.682963 no
Initials YFB_gill_tissue 0.860351 no
Initials YFB_veil 0.206690 no
Initials Pileal_Stipeal_center 0.695943 no
Initials Pileal_Stipeal_shell 0.458854 no
Initials DIF_stipe_center 0.443099 no
Initials DIF_stipe_shell 0.652826 no
Initials DIF_stipe_skin 0.990096 no
Initials DIF_cap_skin 0.407453 no
Initials DIF_cap_tissue 0.963551 no
Pileal_Stipeal_center DIF_gill_tissue 0.533575 no
Pileal_Stipeal_center YFB_stipe_center 0.521681 no
Pileal_Stipeal_center YFB_stipe_shell 0.419413 no
Pileal_Stipeal_center YFB_stipe_skin 0.947829 no
Pileal_Stipeal_center YFB_cap_skin 0.395511 no
Pileal_Stipeal_center YFB_cap_tissue 0.994016 no
Pileal_Stipeal_center YFB_gill_tissue 0.487260 no
Pileal_Stipeal_center YFB_veil 0.056367 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.166316 no
Pileal_Stipeal_center DIF_stipe_center 0.837752 no
Pileal_Stipeal_center DIF_stipe_shell 0.978132 no
Pileal_Stipeal_center DIF_stipe_skin 0.712882 no
Pileal_Stipeal_center DIF_cap_skin 0.135006 no
Pileal_Stipeal_center DIF_cap_tissue 0.744880 no
Pileal_Stipeal_shell DIF_gill_tissue 0.629215 no
Pileal_Stipeal_shell YFB_stipe_center 0.014956 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.011041 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.121416 no
Pileal_Stipeal_shell YFB_cap_skin 0.781795 no
Pileal_Stipeal_shell YFB_cap_tissue 0.163299 no
Pileal_Stipeal_shell YFB_gill_tissue 0.676607 no
Pileal_Stipeal_shell YFB_veil 0.777121 no
Pileal_Stipeal_shell DIF_stipe_center 0.063760 no
Pileal_Stipeal_shell DIF_stipe_shell 0.140982 no
Pileal_Stipeal_shell DIF_stipe_skin 0.443652 no
Pileal_Stipeal_shell DIF_cap_skin 0.966201 no
Pileal_Stipeal_shell DIF_cap_tissue 0.395957 no
DIF_stipe_center DIF_gill_tissue 0.294735 no
DIF_stipe_center YFB_stipe_center 0.751241 no
DIF_stipe_center YFB_stipe_shell 0.648980 no
DIF_stipe_center YFB_stipe_skin 0.907402 no
DIF_stipe_center YFB_cap_skin 0.195079 no
DIF_stipe_center YFB_cap_tissue 0.842728 no
DIF_stipe_center YFB_gill_tissue 0.258191 no
DIF_stipe_center YFB_veil 0.018896 yes
DIF_stipe_center DIF_stipe_shell 0.868049 no
DIF_stipe_center DIF_stipe_skin 0.458708 no
DIF_stipe_center DIF_cap_skin 0.049882 yes
DIF_stipe_center DIF_cap_tissue 0.495245 no
DIF_stipe_shell DIF_gill_tissue 0.490824 no
DIF_stipe_shell YFB_stipe_center 0.555386 no
DIF_stipe_shell YFB_stipe_shell 0.453704 no
DIF_stipe_shell YFB_stipe_skin 0.969159 no
DIF_stipe_shell YFB_cap_skin 0.354208 no
DIF_stipe_shell YFB_cap_tissue 0.981920 no
DIF_stipe_shell YFB_gill_tissue 0.442326 no
DIF_stipe_shell YFB_veil 0.046536 yes
DIF_stipe_shell DIF_stipe_skin 0.671084 no
DIF_stipe_shell DIF_cap_skin 0.117635 no
DIF_stipe_shell DIF_cap_tissue 0.706618 no
DIF_stipe_skin DIF_gill_tissue 0.885780 no
DIF_stipe_skin YFB_stipe_center 0.186435 no
DIF_stipe_skin YFB_stipe_shell 0.134002 no
DIF_stipe_skin YFB_stipe_skin 0.613651 no
DIF_stipe_skin YFB_cap_skin 0.761673 no
DIF_stipe_skin YFB_cap_tissue 0.699188 no
DIF_stipe_skin YFB_gill_tissue 0.849179 no
DIF_stipe_skin YFB_veil 0.201753 no
DIF_stipe_skin DIF_cap_skin 0.391717 no
DIF_stipe_skin DIF_cap_tissue 0.974575 no
DIF_cap_skin DIF_gill_tissue 0.569030 no
DIF_cap_skin YFB_stipe_center 0.009773 yes
DIF_cap_skin YFB_stipe_shell 0.007092 yes
DIF_cap_skin YFB_stipe_skin 0.100411 no
DIF_cap_skin YFB_cap_skin 0.727626 no
DIF_cap_skin YFB_cap_tissue 0.135006 no
DIF_cap_skin YFB_gill_tissue 0.613849 no
DIF_cap_skin YFB_veil 0.829610 no
DIF_cap_skin DIF_cap_tissue 0.342737 no
DIF_cap_tissue DIF_gill_tissue 0.850283 no
DIF_cap_tissue YFB_stipe_center 0.205997 no
DIF_cap_tissue YFB_stipe_shell 0.146718 no
DIF_cap_tissue YFB_stipe_skin 0.653692 no
DIF_cap_tissue YFB_cap_skin 0.714657 no
DIF_cap_tissue YFB_cap_tissue 0.734910 no
DIF_cap_tissue YFB_gill_tissue 0.808936 no
DIF_cap_tissue YFB_veil 0.167110 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014490
MISFKPLLLAASAAVAAMAMPHFANNTESHLLLPRQLITTSSTGNVNGYFYSLWMQSNTGATMDIQSGSYSMNWQ
SSSQNVVGGIGWNPGSSQAISYSGSFNCAANCYLSIYGWTENPLIEYYVVESYGTYNPGSAAQLLGTVNSDGGTY
NIYHTVRVNQPSIHGTATFDQFWSVRTSHRVGGTVTIANHFNAWASHGLTLGSHNYQIVASEGYQSGGSSSLSVS
HGGGSTPPPSTTSNPGPITTQPGGGGGSTSPHWGQCGGQGCNQSLLLSMLVKVGLNDKMIGY*
Coding >AgabiH97|014490
ATGATTTCCTTCAAGCCTCTTCTCCTTGCTGCTTCAGCGGCTGTGGCTGCTATGGCGATGCCGCATTTCGCCAAC
AACACCGAGTCTCATTTACTTCTCCCTCGCCAGCTCATCACTACCAGCTCTACGGGTAATGTTAACGGCTACTTC
TACTCATTGTGGATGCAATCCAATACCGGTGCCACGATGGACATCCAGAGTGGCTCATACAGTATGAATTGGCAA
TCGTCTAGTCAAAACGTCGTTGGTGGCATTGGCTGGAACCCCGGAAGTTCTCAAGCGATCTCTTACAGTGGTAGC
TTCAATTGCGCTGCGAACTGCTACTTGTCGATCTATGGATGGACCGAAAACCCACTCATCGAGTATTACGTCGTC
GAATCTTACGGTACCTATAACCCTGGTAGCGCAGCTCAACTCTTGGGTACCGTGAACTCTGACGGTGGAACATAC
AACATCTACCACACCGTCCGCGTGAACCAACCTTCGATCCACGGAACTGCTACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCGTCGGTGGTACCGTCACCATCGCCAACCACTTCAATGCATGGGCGAGTCACGGTCTCACC
TTAGGTTCGCACAACTACCAGATCGTTGCTTCGGAGGGTTACCAGAGTGGCGGTTCCTCCTCCCTCTCCGTCTCC
CACGGAGGAGGTTCTACACCCCCGCCAAGCACAACCAGCAACCCAGGACCCATTACCACTCAGCCCGGTGGTGGT
GGTGGCTCAACCTCCCCACACTGGGGTCAATGCGGTGGTCAAGGATGTAATCAATCCTTATTACTCTCAATGCTT
GTAAAGGTTGGGTTAAACGATAAGATGATAGGTTATTAA
Transcript >AgabiH97|014490
ATGATTTCCTTCAAGCCTCTTCTCCTTGCTGCTTCAGCGGCTGTGGCTGCTATGGCGATGCCGCATTTCGCCAAC
AACACCGAGTCTCATTTACTTCTCCCTCGCCAGCTCATCACTACCAGCTCTACGGGTAATGTTAACGGCTACTTC
TACTCATTGTGGATGCAATCCAATACCGGTGCCACGATGGACATCCAGAGTGGCTCATACAGTATGAATTGGCAA
TCGTCTAGTCAAAACGTCGTTGGTGGCATTGGCTGGAACCCCGGAAGTTCTCAAGCGATCTCTTACAGTGGTAGC
TTCAATTGCGCTGCGAACTGCTACTTGTCGATCTATGGATGGACCGAAAACCCACTCATCGAGTATTACGTCGTC
GAATCTTACGGTACCTATAACCCTGGTAGCGCAGCTCAACTCTTGGGTACCGTGAACTCTGACGGTGGAACATAC
AACATCTACCACACCGTCCGCGTGAACCAACCTTCGATCCACGGAACTGCTACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCGTCGGTGGTACCGTCACCATCGCCAACCACTTCAATGCATGGGCGAGTCACGGTCTCACC
TTAGGTTCGCACAACTACCAGATCGTTGCTTCGGAGGGTTACCAGAGTGGCGGTTCCTCCTCCCTCTCCGTCTCC
CACGGAGGAGGTTCTACACCCCCGCCAAGCACAACCAGCAACCCAGGACCCATTACCACTCAGCCCGGTGGTGGT
GGTGGCTCAACCTCCCCACACTGGGGTCAATGCGGTGGTCAAGGATGTAATCAATCCTTATTACTCTCAATGCTT
GTAAAGGTTGGGTTAAACGATAAGATGATAGGTTATTAA
Gene >AgabiH97|014490
ATGATTTCCTTCAAGCCTCTTCTCCTTGCTGCTTCAGCGGCTGTGGCTGCTATGGCGATGCCGCATTTCGCCAAC
AACACCGAGTCTCATTTACTTCTCCCTCGCCAGCTCATCACTACCAGCTCTACGGGTAATGTTAACGGCTACTTC
TACTCATTGTGGATGCAATCCAATACCGGTGCCACGATGGACATCCAGAGTGGCTCATACAGTATGAATTGGCAA
TCGTCTAGTCAAAACGTCGTTGGTGGCATTGGCTGGAACCCCGGAAGTTCTCAGTTCGTGGTCATGCTCATATGA
ATATTGGCACTAATGGATCTGACGGTCTTGACAAATTTAGAGCGATCTCTTACAGTGGTAGCTTCAATTGCGCTG
CGAACTGCTACTTGTCGATCTATGGATGGACCGAAAACCCACTCATCGAGTATTACGTCGTCGAATCTTACGGTA
CCTATAACCCTGGTAGCGCAGCTCAACTCTTGGGTACCGTGAACTCTGACGGTGGAACATACAACATCTACCACA
CCGTCCGCGTGAACCAACCTTCGATCCACGGAACTGCTACGTTCGACCAGTTCTGGTCCGTCCGCACGTCCCACC
GCGTCGGTGGTACCGTCACCATCGCCAACCACTTCAATGCATGGGCGAGTCACGGTCTCACCTTAGGTTCGCACA
ACTACCAGATCGTTGCTTCGGAGGGTTACCAGAGTGGCGGTTCCTCCTCCCTCTCCGTCTCCCACGGAGGAGGTT
CTACACCCCCGCCAAGCACAACCAGCAACCCAGGACCCATTACCACTCAGCCCGGTGGTGGTGGTGGCTCAACCT
CCCCACACTGGGGTCAATGCGGTGGTCAAGGATGGTCTGGCCCAACTGCTTGCCAATCGCCTTACACTTGCCAAG
TAATCAATCGTATGTTTTCCGCTCAATTCTGGATTAATTTTTTTCTGACGTTGTTGCGCAGCTTATTACTCTCAA
TGCTTGTAAAGGTTGGGTTAAACGATAAGGTACGGTTCATTTCCGGGGCTGTGATAAGAATTCTACGTCTCACAC
AAGTTGTGTATTCTCTTTTTCTTTCTTTCCTTGCAGATGATAGGTTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail