Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014390
Gene name
Locationscaffold_1:3429765..3433344
Strand-
Gene length (bp)3579
Transcript length (bp)2712
Coding sequence length (bp)2712
Protein length (aa) 904

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 3.1E-71 97 328
PF16335 DUF4965 Domain of unknown function (DUF4965) 1.1E-50 335 502
PF08760 DUF1793 Domain of unknown function (DUF1793) 7.2E-27 517 686

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 638 1.0E-103
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 7 661 1.0E-49

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 713 735 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014390
MLILYFFLSFGLQAYAQSPSSLGDFPLAVKTPYLHAWTRNADGNAPQHVWPQLFTQGHILAWNAMVRVDGQPYQW
LGSSNPNVANFSATTSSEITPTSTIFTIQAGPMKFKATFFTPIEPNDYTRQSIPFTYLFVDGFVADDGNPHTIQL
YSDISGEWISHDLSTQMKWGTQDPPDNMVYHHLEPRDPKSMIDNADSAEDATVYYAAPKRPGLTWQTGTDTDCRI
RFAKSGSLINSKDTNFRPVNRKWPVFSFAIDLGSITPTTQPDPVVWALGLVRDPLVNYSAGSGFQPRIGYYWSAY
HGIDDVISDFLGDFANARVRGQAFDDGLLKAASAISPEYAGIISLVTRQIFASMDITIAAGQRGRTSPSDVKIFM
KDVSVSNRANPVEVIYAALPALLYFNSSLTHDLLLPLFEFQSSSSYPNGYASPDLGSGYPTISGNTSATEELAIE
HCGNMLIMAYAHAAKSGDGSLISKYHSLLQKWAAYLVQNSLHPNNAVSADGISYPGMSNLALKGILGVYSMGKID
EHINPSNTTFRDKANELIQSWKQLAVTDTHIQAEYGKPGTWGLMYNLFPAVWLETGLIDDEILNREAQFYLSQAP
PGDQSYSLDVDAGSDIAYPHWSLMTAAIMPSGFTSVRDTLIKSTHFQAYNISQQFPLPMRYTASTGVASFGTTGS
AAQGAAFGILAMNLQNVEISRSNSGGSGNVEKRTPIGAIVGGVIGGLAFVLIVAAAIFFWRRRRVRHPRGVIDLH
DKHHAKPYAPVNDNDNAFQFPQQLSDASLSPPTWQGSLSEPFSDPQPSESSLSYASGRNHMSVTPTSPITAPQPL
SSKQREILRHNQSHQSQPSVSAVSTLTNPWSAAGSGREEVLRAEVGELRRGMEAIRIIAQPPPRSDSIRGGSPVM
RRP*
Coding >AgabiH97|014390
ATGCTTATCCTCTACTTCTTCCTTTCATTTGGACTACAGGCTTATGCCCAATCTCCCAGCTCGCTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGACTCGGAATGCCGACGGTAATGCCCCCCAACACGTATGG
CCACAGCTCTTCACACAAGGACATATTCTGGCGTGGAATGCGATGGTTCGGGTAGATGGCCAACCCTACCAATGG
TTGGGCAGTTCAAATCCAAATGTCGCCAACTTCTCGGCCACAACCTCCAGCGAAATAACCCCGACTAGCACAATA
TTTACCATTCAAGCTGGTCCCATGAAATTCAAAGCTACCTTCTTTACCCCAATCGAGCCAAACGACTACACTCGT
CAATCGATCCCGTTCACCTACCTATTCGTTGATGGCTTCGTCGCAGACGATGGAAACCCACACACAATCCAACTG
TATTCCGACATCTCTGGTGAATGGATAAGCCACGACTTGTCGACGCAGATGAAATGGGGCACACAAGACCCGCCG
GACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCAATGATTGATAACGCTGATTCAGCGGAGGAC
GCAACCGTATACTATGCCGCACCAAAGCGGCCTGGCCTCACCTGGCAGACAGGTACCGATACTGATTGCAGGATT
AGGTTTGCGAAGAGCGGTAGTTTGATCAACTCCAAAGACACCAACTTCCGTCCTGTGAATAGAAAGTGGCCCGTC
TTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACCACTCAACCAGACCCTGTTGTTTGGGCGCTGGGCCTC
GTACGCGATCCCTTAGTGAACTATTCAGCTGGATCGGGGTTTCAACCTCGAATAGGTTATTACTGGTCAGCATAC
CACGGTATTGACGATGTGATCTCGGATTTCCTCGGGGATTTTGCGAATGCCAGAGTCAGAGGCCAGGCTTTCGAC
GATGGTCTTCTCAAAGCAGCATCCGCTATTTCACCGGAATACGCAGGAATAATTTCGCTGGTGACAAGACAAATA
TTTGCATCGATGGATATCACGATTGCGGCCGGCCAAAGAGGACGGACGAGTCCGTCCGATGTAAAAATATTCATG
AAGGACGTTTCTGTGTCCAATCGTGCTAATCCTGTCGAAGTTATCTATGCCGCACTACCTGCATTGCTTTACTTC
AACTCCTCACTCACCCATGATCTCTTACTTCCTTTATTTGAATTTCAGTCATCGTCGTCTTATCCGAACGGTTAC
GCATCACCCGATCTTGGAAGTGGATACCCAACTATCAGTGGGAACACTAGCGCTACTGAAGAGCTTGCAATCGAG
CATTGCGGCAACATGCTCATCATGGCTTATGCTCATGCAGCCAAATCCGGTGATGGTTCTCTCATCTCTAAATAT
CATTCGCTGCTACAAAAATGGGCAGCTTACCTTGTTCAAAATTCATTACATCCGAATAATGCTGTATCAGCGGAT
GGTATTAGCTACCCCGGAATGTCCAATCTAGCATTGAAGGGAATCCTGGGAGTTTACTCTATGGGAAAGATAGAC
GAGCATATCAATCCATCTAACACTACTTTCAGGGATAAGGCAAATGAACTCATTCAGAGCTGGAAACAACTTGCC
GTGACAGACACGCATATTCAAGCTGAATACGGAAAGCCGGGCACATGGGGATTGATGTACAATCTCTTCCCTGCC
GTTTGGCTCGAGACTGGTCTAATCGATGATGAAATTCTAAATCGTGAAGCGCAATTCTACCTCTCTCAAGCACCC
CCTGGGGATCAAAGCTACAGCCTCGACGTTGACGCAGGCTCCGATATTGCTTACCCTCATTGGTCTCTCATGACT
GCAGCAATAATGCCCTCCGGATTCACGTCTGTCCGCGACACCCTCATCAAGTCAACACATTTCCAGGCATACAAC
ATATCGCAGCAATTCCCATTGCCGATGAGATATACAGCATCGACTGGAGTTGCTAGTTTTGGGACCACAGGAAGT
GCTGCTCAAGGCGCCGCCTTTGGAATTCTGGCAATGAATTTGCAGAATGTTGAAATAAGCCGTTCGAACTCTGGG
GGCAGCGGTAATGTTGAAAAGAGAACTCCAATCGGTGCAATTGTTGGAGGCGTAATTGGCGGTCTTGCATTCGTT
CTCATCGTTGCGGCTGCCATTTTCTTCTGGCGTAGACGAAGGGTGCGCCATCCCAGAGGTGTTATTGATCTCCAC
GATAAGCACCACGCCAAACCATACGCTCCAGTCAATGACAACGATAATGCATTCCAATTCCCACAACAACTCTCT
GATGCGAGTCTCTCTCCGCCAACCTGGCAGGGATCTTTGTCCGAACCATTTTCAGACCCACAACCTTCGGAAAGT
TCACTGTCATATGCTAGTGGGAGGAATCATATGTCTGTAACCCCCACTTCGCCGATCACGGCCCCCCAACCGTTA
TCATCTAAGCAACGAGAAATTCTCCGACATAACCAATCTCATCAATCTCAACCTTCTGTGTCAGCTGTGTCGACC
CTCACTAATCCATGGTCGGCAGCCGGATCAGGAAGGGAAGAAGTTTTGAGGGCTGAAGTAGGTGAGCTGAGAAGA
GGAATGGAGGCAATCAGAATTATTGCACAACCCCCGCCTAGGAGCGACTCCATCCGTGGTGGAAGTCCAGTCATG
CGCAGACCATAG
Transcript >AgabiH97|014390
ATGCTTATCCTCTACTTCTTCCTTTCATTTGGACTACAGGCTTATGCCCAATCTCCCAGCTCGCTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGACTCGGAATGCCGACGGTAATGCCCCCCAACACGTATGG
CCACAGCTCTTCACACAAGGACATATTCTGGCGTGGAATGCGATGGTTCGGGTAGATGGCCAACCCTACCAATGG
TTGGGCAGTTCAAATCCAAATGTCGCCAACTTCTCGGCCACAACCTCCAGCGAAATAACCCCGACTAGCACAATA
TTTACCATTCAAGCTGGTCCCATGAAATTCAAAGCTACCTTCTTTACCCCAATCGAGCCAAACGACTACACTCGT
CAATCGATCCCGTTCACCTACCTATTCGTTGATGGCTTCGTCGCAGACGATGGAAACCCACACACAATCCAACTG
TATTCCGACATCTCTGGTGAATGGATAAGCCACGACTTGTCGACGCAGATGAAATGGGGCACACAAGACCCGCCG
GACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCAATGATTGATAACGCTGATTCAGCGGAGGAC
GCAACCGTATACTATGCCGCACCAAAGCGGCCTGGCCTCACCTGGCAGACAGGTACCGATACTGATTGCAGGATT
AGGTTTGCGAAGAGCGGTAGTTTGATCAACTCCAAAGACACCAACTTCCGTCCTGTGAATAGAAAGTGGCCCGTC
TTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACCACTCAACCAGACCCTGTTGTTTGGGCGCTGGGCCTC
GTACGCGATCCCTTAGTGAACTATTCAGCTGGATCGGGGTTTCAACCTCGAATAGGTTATTACTGGTCAGCATAC
CACGGTATTGACGATGTGATCTCGGATTTCCTCGGGGATTTTGCGAATGCCAGAGTCAGAGGCCAGGCTTTCGAC
GATGGTCTTCTCAAAGCAGCATCCGCTATTTCACCGGAATACGCAGGAATAATTTCGCTGGTGACAAGACAAATA
TTTGCATCGATGGATATCACGATTGCGGCCGGCCAAAGAGGACGGACGAGTCCGTCCGATGTAAAAATATTCATG
AAGGACGTTTCTGTGTCCAATCGTGCTAATCCTGTCGAAGTTATCTATGCCGCACTACCTGCATTGCTTTACTTC
AACTCCTCACTCACCCATGATCTCTTACTTCCTTTATTTGAATTTCAGTCATCGTCGTCTTATCCGAACGGTTAC
GCATCACCCGATCTTGGAAGTGGATACCCAACTATCAGTGGGAACACTAGCGCTACTGAAGAGCTTGCAATCGAG
CATTGCGGCAACATGCTCATCATGGCTTATGCTCATGCAGCCAAATCCGGTGATGGTTCTCTCATCTCTAAATAT
CATTCGCTGCTACAAAAATGGGCAGCTTACCTTGTTCAAAATTCATTACATCCGAATAATGCTGTATCAGCGGAT
GGTATTAGCTACCCCGGAATGTCCAATCTAGCATTGAAGGGAATCCTGGGAGTTTACTCTATGGGAAAGATAGAC
GAGCATATCAATCCATCTAACACTACTTTCAGGGATAAGGCAAATGAACTCATTCAGAGCTGGAAACAACTTGCC
GTGACAGACACGCATATTCAAGCTGAATACGGAAAGCCGGGCACATGGGGATTGATGTACAATCTCTTCCCTGCC
GTTTGGCTCGAGACTGGTCTAATCGATGATGAAATTCTAAATCGTGAAGCGCAATTCTACCTCTCTCAAGCACCC
CCTGGGGATCAAAGCTACAGCCTCGACGTTGACGCAGGCTCCGATATTGCTTACCCTCATTGGTCTCTCATGACT
GCAGCAATAATGCCCTCCGGATTCACGTCTGTCCGCGACACCCTCATCAAGTCAACACATTTCCAGGCATACAAC
ATATCGCAGCAATTCCCATTGCCGATGAGATATACAGCATCGACTGGAGTTGCTAGTTTTGGGACCACAGGAAGT
GCTGCTCAAGGCGCCGCCTTTGGAATTCTGGCAATGAATTTGCAGAATGTTGAAATAAGCCGTTCGAACTCTGGG
GGCAGCGGTAATGTTGAAAAGAGAACTCCAATCGGTGCAATTGTTGGAGGCGTAATTGGCGGTCTTGCATTCGTT
CTCATCGTTGCGGCTGCCATTTTCTTCTGGCGTAGACGAAGGGTGCGCCATCCCAGAGGTGTTATTGATCTCCAC
GATAAGCACCACGCCAAACCATACGCTCCAGTCAATGACAACGATAATGCATTCCAATTCCCACAACAACTCTCT
GATGCGAGTCTCTCTCCGCCAACCTGGCAGGGATCTTTGTCCGAACCATTTTCAGACCCACAACCTTCGGAAAGT
TCACTGTCATATGCTAGTGGGAGGAATCATATGTCTGTAACCCCCACTTCGCCGATCACGGCCCCCCAACCGTTA
TCATCTAAGCAACGAGAAATTCTCCGACATAACCAATCTCATCAATCTCAACCTTCTGTGTCAGCTGTGTCGACC
CTCACTAATCCATGGTCGGCAGCCGGATCAGGAAGGGAAGAAGTTTTGAGGGCTGAAGTAGGTGAGCTGAGAAGA
GGAATGGAGGCAATCAGAATTATTGCACAACCCCCGCCTAGGAGCGACTCCATCCGTGGTGGAAGTCCAGTCATG
CGCAGACCATAG
Gene >AgabiH97|014390
ATGCTTATCCTCTACTTCTTCCTTTCATTTGGACTACAGGCTTATGCCCAATCTCCCAGCTCGCTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGACTCGGAATGCCGACGGTAATGCCCCCCAACACGTATGG
CCACAGCTCTTCACACAAGGACATGTGAGTCATTGTTTGTAATAAGGCCAAAAGATTATCTCATTGAGTTCTTTG
AACCCAGATTCTGGCGTGGAATGCGATGGTTCGGGTAGATGGCCAACCCTACCAATGGTTGGGCAGTTCAAATCC
AAATGTCGCCAACTTCTCGGCCACAACCTCCAGCGAAATAACCCCGACTAGCACAATATTTACCATTCAAGCTGG
TCCCATGAAATTCAAAGCTACCTTCTTTACCCCAATCGAGGTTAATTTTCTTCATTGTTCACGATCGCGTTACCC
TGAACGTTAACACAGCCAAACGACTACACTCGTCAATCGATCCCGTTCACCTACCTATTCGTTGATGGCTTCGTC
GCAGACGATGGAAACCCACACACAATCCAACTGTATTCCGACATCTCTGGTGGTCAGCATAATCCTCATTGATAC
TATGTCGAAGGACGCTGATAAATACCTTAGAATGGATAAGCCACGACTTGTCGACGCAGATGAAATGGGGCACAC
AAGACCCGCCGGACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCAATGATTGATAACGCTGATT
CAGCGGAGGACGCAACCGTATACTATGCCGCACCAAAGGTGAATAGAAGGAGTGCTTCTCCTGGTTCACTTCCTG
ACCGCTCCCTACAGCGGCCTGGCCTCACCTGGCAGACAGGTACCGATACTGATTGCAGGATTAGGTTTGCGAAGA
GCGGTAGTTTGATCAACTCCAAAGACACCAACTTCCGTCCTGTGAATAGGTGTGTTTTTCCAACAGAATGAGGTC
TATCGTTGACAAATTTCCATCAGAAAGTGGCCCGTCTTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACC
ACTCAACCAGACCCTGTTGTTTGGGCGCTGGGCCTCGTACGCGATCCCTTAGTGAACTATTCAGCTGGATCGGGG
TTTCAACCTCGAATAGGTTATTACTGGTCAGCATACCACGGTATTGACGATGTGGTACGTGTTCATCCTCATCCC
GATACTCATGATGACGAATATGCCAAACTTAGATCTCGGATTTCCTCGGGGATTTTGCGAATGCCAGAGTCAGAG
GCCAGGCTTTCGACGATGGTCTTCTCAAAGCAGCATCCGCTATTTCACCGGAATACGCAGGAATAATTTCGCTGG
TGACAAGACAAATATTTGCATCGATGGATATCACGATTGCGGCCGGCCAAAGAGGACGGACGAGTCCGTCCGATG
TAAAAATATTCATGAAGGACGTTTCTGTGTCCAAGTGAGCACAACGACGGCCATGTAGAGTCGCTGCTAACTCCC
AATGACCAGTCGTGCTAATCCTGTCGAAGTTATCTATGCCGCACTACCTGCATTGCTTTACTTCAACTCCTCACT
CACCCATGATCTCTTACTTCCTTTATTTGAATTTCAGTCATCGTCGTCTTATCCGAACGGTTACGCATCACCCGA
TCTTGGTCCGTATAATCACTGTAACTTTATCATTCATTTCAAGTACTAAACCGTGTGCTTACAGGAAGTGGATAC
CCAACTATCAGTGGGAACACTAGCGCTACTGAAGAGCTTGCAATCGAGCGTACGTAGCGGTCGGATTGTCATTCG
TTCCGTTAATCCAGAGTTCGCACGACAGATTGCGGCAACATGCTCATCATGGCTTATGCTCATGCAGCCAAATCC
GGTGATGGTTCTCTCATCTCTAAATATGTCAGTAGGCTTCTCCATTCATGGGGCGTATAGGCCTGACAAACTCGA
TTAGCATTCGCTGCTACAAAAATGGGCAGCTTACCTTGTTCAAAATTCATTACATCCGAATAATGCTGTATCAGC
GGATGGTATTAGCTACCCCGGAATGTCCAATCTAGCATTGAAGGGAATCCTGGGAGTTTACTCTATGGGAAAGAT
AGACGAGCATATCAATCCATCTAACACTACTTTCAGGGTGAGTTATCGGCGGATGGATTGGAGCGTTCTGACGCG
ATATTCTTAGGATAAGGCAAATGAACTCATTCAGAGCTGGAAACAACTTGCCGTGACAGACACGCATATTCAAGC
TGAATACGGAAAGCCGGGCACATGGGGATTGATGTACAATCTCTTCCCTGCCGTTTGGCTCGAGACTGGTCTAAT
CGATGATGAAGTATGTTTTTCCCTTGAGGATATCCTTCTGCATCTCGATATATAATCAAATAAAAAACAGATTCT
AAATCGTGAAGCGCAATTCTACCTCTCTCAAGCACGTAAGTACTTCAAAGGTATCGCTATATGCCCATTCCTTAT
ACTCCCTTTTCTACAGCCCCTGGGGATCAAAGCTACAGCCTCGACGTTGACGCAGGCTCCGATATTGCTTACCCT
CGTATGTGTAGCCCCCGAAACGTGTTCCCAGGTATGACGCTAACACTGATCATGCATTCTAGATTGGTCTCTCAT
GACTGCAGCAATAATGCCCTCCGGATTCACGTCTGTCCGCGACACCCTCATCAAGTCAACACATTTCCAGGCATA
CAACATATCGCAGCAATTCCCATTGCCGATGAGATATACAGCATCGACTGGAGTTGCTAGTTTTGGGACCACAGG
AAGGTCAGTGCTACGTTGATTGGGTACATAATTCACATCAAGCTTATCGACTGCCGCCAGTGCTGCTCAAGGCGC
CGCCTTTGGAATTCTGGCAATGAAGTTCGTTTCCATTCTATGCATAATTTACTGCCTCTGACTCGTATATGCTTC
GTTAGTTTGCAGAATGTTGAAATAAGCCGTTCGAACTCTGGGGGCAGCGGTAATGTTGAAAAGAGAACTCCAATC
GGTGCAATTGTTGGAGGCGTAATTGGCGGTCTTGCATTCGTTCTCATCGTTGCGGCTGCCATTTTCTTCTGGCGT
AGACGAAGGGTGCGCCATCCCAGAGGTGTTATTGATCTCCACGATAAGCACCACGCCAAACCATACGCTCCAGTC
AATGACAACGATAATGCATTCCAATTCCCACAACAACTCTCTGATGCGAGTCTCTCTCCGCCAACCTGGCAGGGA
TCTTTGTCCGAACCATTTTCAGACCCACAACCTTCGGAAAGTTCACTGTCATATGCTAGTGGGAGGAATCATATG
TCTGTAACCCCCACTTCGCCGATCACGGCCCCCCAACCGTTATCATCTAAGCAACGAGAAATTCTCCGACATAAC
CAATCTCATCAATCTCAACCTTCTGTGTCAGCTGTGTCGACCCTCACTAATCCATGGTCGGCAGCCGGATCAGGA
AGGGAAGAAGTTTTGAGGGCTGAAGTAGGTGAGCTGAGAAGAGGAATGGAGGCAATCAGAATTATTGCACAACCC
CCGCCTAGGAGCGACTCCATCCGTGGTGGAAGTCCAGTCATGCGCAGACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail