Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014270
Gene name
Locationscaffold_1:3392581..3394809
Strand-
Gene length (bp)2228
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 9.9E-07 3 39
PF00646 F-box F-box domain 1.5E-06 2 40

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6675 0.4868 0.0475 0.0227 0.1319 0.0087 0.41 0.1342 0.2908 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 18.06 9.54 26.59
Initials Initials knots 12.92 6.98 18.86
Pileal_Stipeal_center Stage I stipe center 5.15 2.45 7.85
Pileal_Stipeal_shell Stage I stipe shell 1.62 0.63 2.61
DIF_stipe_center Stage II stipe center 4.50 2.05 6.94
DIF_stipe_shell Stage II stipe shell 7.19 3.59 10.79
DIF_stipe_skin Stage II stipe skin 5.10 2.43 7.76
DIF_cap_skin Stage II cap skin 1.02 0.34 1.69
DIF_cap_tissue Stage II cap tissue 1.78 0.62 2.94
DIF_gill_tissue Stage II gill tissue 2.98 1.28 4.68
YFB_stipe_center Young fruiting body stipe center 3.21 1.32 5.10
YFB_stipe_shell Young fruiting body stipe shell 5.75 2.68 8.82
YFB_stipe_skin Young fruiting body stipe skin 6.51 3.17 9.86
YFB_cap_skin Young fruiting body cap skin 1.05 0.36 1.74
YFB_cap_tissue Young fruiting body cap tissue 1.22 0.44 2.01
YFB_gill_tissue Young fruiting body gill tissue 3.48 1.51 5.44
YFB_veil Young fruiting body veil 3.98 1.54 6.41

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.001140 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.372663 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.002951 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.921498 no
DIF_gill_tissue YFB_stipe_shell 0.081927 no
DIF_gill_tissue YFB_stipe_skin 0.033906 yes
DIF_gill_tissue YFB_cap_skin 0.008457 yes
DIF_gill_tissue YFB_cap_tissue 0.027943 yes
DIF_gill_tissue YFB_gill_tissue 0.815411 no
DIF_gill_tissue YFB_veil 0.599131 no
YFB_stipe_center YFB_stipe_shell 0.147817 no
YFB_stipe_center YFB_stipe_skin 0.062038 no
YFB_stipe_center YFB_cap_skin 0.002525 yes
YFB_stipe_center YFB_cap_tissue 0.016386 yes
YFB_stipe_center YFB_gill_tissue 0.916270 no
YFB_stipe_center YFB_veil 0.728093 no
YFB_stipe_shell YFB_stipe_skin 0.843631 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.225481 no
YFB_stipe_shell YFB_veil 0.437018 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.100249 no
YFB_stipe_skin YFB_veil 0.247691 no
YFB_cap_skin YFB_cap_tissue 0.844325 no
YFB_cap_skin YFB_gill_tissue 0.000613 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.006742 yes
YFB_cap_tissue YFB_veil 0.002525 yes
YFB_gill_tissue YFB_veil 0.842186 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.011968 yes
Initials YFB_stipe_skin 0.035537 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.001140 yes
Initials Pileal_Stipeal_center 0.002084 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.001625 yes
Initials DIF_stipe_shell 0.070681 no
Initials DIF_stipe_skin 0.003365 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.172181 no
Pileal_Stipeal_center YFB_stipe_center 0.254947 no
Pileal_Stipeal_center YFB_stipe_shell 0.856681 no
Pileal_Stipeal_center YFB_stipe_skin 0.638725 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.378727 no
Pileal_Stipeal_center YFB_veil 0.627627 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.001625 yes
Pileal_Stipeal_center DIF_stipe_center 0.822248 no
Pileal_Stipeal_center DIF_stipe_shell 0.437800 no
Pileal_Stipeal_center DIF_stipe_skin 0.988035 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.004928 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.150164 no
Pileal_Stipeal_shell YFB_stipe_center 0.096464 no
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.392592 no
Pileal_Stipeal_shell YFB_cap_tissue 0.644306 no
Pileal_Stipeal_shell YFB_gill_tissue 0.052135 no
Pileal_Stipeal_shell YFB_veil 0.020523 yes
Pileal_Stipeal_shell DIF_stipe_center 0.005671 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.001140 yes
Pileal_Stipeal_shell DIF_cap_skin 0.353874 no
Pileal_Stipeal_shell DIF_cap_tissue 0.902735 no
DIF_stipe_center DIF_gill_tissue 0.359694 no
DIF_stipe_center YFB_stipe_center 0.481021 no
DIF_stipe_center YFB_stipe_shell 0.625577 no
DIF_stipe_center YFB_stipe_skin 0.392671 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.622426 no
DIF_stipe_center YFB_veil 0.855438 no
DIF_stipe_center DIF_stipe_shell 0.225157 no
DIF_stipe_center DIF_stipe_skin 0.836495 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.020790 yes
DIF_stipe_shell DIF_gill_tissue 0.013485 yes
DIF_stipe_shell YFB_stipe_center 0.021322 yes
DIF_stipe_shell YFB_stipe_shell 0.655917 no
DIF_stipe_shell YFB_stipe_skin 0.873971 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.042260 yes
DIF_stipe_shell YFB_veil 0.132709 no
DIF_stipe_shell DIF_stipe_skin 0.412746 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.183181 no
DIF_stipe_skin YFB_stipe_center 0.265252 no
DIF_stipe_skin YFB_stipe_shell 0.842470 no
DIF_stipe_skin YFB_stipe_skin 0.618223 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.389694 no
DIF_stipe_skin YFB_veil 0.643283 no
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.005302 yes
DIF_cap_skin DIF_gill_tissue 0.006387 yes
DIF_cap_skin YFB_stipe_center 0.003765 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.968799 no
DIF_cap_skin YFB_cap_tissue 0.797242 no
DIF_cap_skin YFB_gill_tissue 0.001140 yes
DIF_cap_skin YFB_veil 0.001140 yes
DIF_cap_skin DIF_cap_tissue 0.257773 no
DIF_cap_tissue DIF_gill_tissue 0.282026 no
DIF_cap_tissue YFB_stipe_center 0.197355 no
DIF_cap_tissue YFB_stipe_shell 0.002525 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.288390 no
DIF_cap_tissue YFB_cap_tissue 0.507842 no
DIF_cap_tissue YFB_gill_tissue 0.127200 no
DIF_cap_tissue YFB_veil 0.061844 no

Orthologs

Orthofinder run ID1
Orthogroup1379
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|014270
Agaricus bisporus var bisporus H97 AgabiH97|014270 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|47_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014270
MLLSLPSELLLSILRHLSLPDLATCILTSKAFKAVIDDCESTVYRQAAAHPSLRLIPHDEVLFSELVPLGLVSSR
FLGKAKTWKQLCRRACDVRQSWLGKGPSRTKSLHNNYHNVHRIKVDEERGFFITTHGSQAIVPFGVFNPNSGGLV
VADITDGTPIWIMYSPRIRSHAHCEYAEGFLVFDRYNGMKEIWRLVSDDLNLRAPEPCEVVPQSQPDERQLSQEH
IISAPGSRFKFVPHALIRPVDDIQTNAYRLSYPTLLSAGGGCLFLWDVRTGKLVERMNDIESQSPAPLGTQHLNH
PDGDNVLDGIRYVDVNDKYAFVCGRRSIKAFRRHTHPDPSPTATQSGSSDGSPTACCVMALFQSDLQREGKWAYE
AQYVEEYELPLGISLPASPESEASTVDWLEDSHDEIPNEGDNRWVTESDEEEREENPGDEQIYLAPGRWRHPEKV
VVRHILAFTSLPVTPRPKVEYGFDQPCVAMHVSPCGEHLAILGPQGRLLIIPYFERVIDRHVEDITDIMIDIQLN
LSYSNSESIYLAYEHGRIAVVTSWGLYIIHPSFPAPDDFYTYPDIHVQRVATLNNTNILREVSCLQMTATAVWLN
WHVELNPDGSVSNDYPSQIQSEESYERGTEVFGEIPRSSTVVSVDFGLGS*
Coding >AgabiH97|014270
ATGTTACTCAGTCTCCCTTCTGAATTGTTATTGTCTATTCTCCGCCACCTATCACTGCCTGATTTGGCTACGTGC
ATCCTTACTTCCAAAGCTTTCAAGGCTGTTATAGATGACTGTGAATCAACTGTATATCGCCAGGCAGCTGCACAC
CCAAGTTTGCGGTTGATTCCCCACGATGAAGTACTCTTCTCTGAACTCGTACCTCTTGGTCTTGTGTCGAGCCGA
TTTTTGGGCAAGGCAAAGACATGGAAGCAACTTTGTCGCAGAGCTTGTGACGTTCGGCAGAGTTGGCTTGGCAAA
GGACCATCGCGGACCAAAAGCCTCCATAATAATTACCATAACGTGCACCGCATCAAAGTTGATGAAGAACGAGGA
TTTTTTATCACGACTCATGGATCACAGGCCATAGTTCCGTTTGGCGTGTTCAACCCCAATTCGGGCGGGTTGGTA
GTGGCTGATATCACTGACGGCACACCAATATGGATAATGTACTCCCCCCGAATTCGTTCACATGCACATTGCGAA
TATGCCGAGGGCTTCCTTGTTTTCGATCGTTACAACGGTATGAAAGAAATTTGGCGACTTGTCAGCGACGATCTC
AATCTGCGCGCTCCTGAACCTTGCGAGGTAGTGCCCCAGTCACAACCTGATGAGCGTCAACTCAGCCAGGAGCAT
ATAATTTCTGCTCCTGGGAGTCGATTCAAATTTGTTCCACACGCGCTCATCCGTCCGGTTGATGATATTCAAACG
AATGCTTACAGATTGTCTTATCCGACATTACTGTCGGCCGGAGGCGGGTGCCTGTTTCTGTGGGATGTGAGGACA
GGGAAGCTAGTCGAAAGGATGAATGACATTGAGTCACAGTCACCTGCACCGCTTGGTACGCAACATTTAAATCAT
CCAGATGGCGATAACGTGCTTGATGGAATTCGCTACGTCGATGTGAACGACAAGTATGCGTTTGTATGTGGTAGA
CGAAGTATCAAAGCATTTCGACGGCATACTCATCCCGATCCTTCACCGACGGCGACGCAATCAGGTTCATCAGAT
GGGTCGCCAACTGCTTGTTGTGTGATGGCACTTTTCCAATCCGATCTCCAACGTGAAGGGAAATGGGCGTATGAG
GCCCAATACGTCGAAGAATATGAATTGCCTCTAGGAATTTCACTCCCCGCATCTCCCGAATCCGAAGCCAGTACA
GTAGACTGGTTGGAAGATTCTCACGACGAGATACCCAATGAGGGTGACAATAGATGGGTTACTGAGAGTGACGAA
GAGGAGAGAGAAGAAAATCCGGGTGACGAACAAATCTATCTTGCTCCCGGTAGATGGCGACACCCCGAAAAAGTG
GTAGTGAGGCACATATTGGCTTTCACTTCTCTACCTGTGACACCAAGGCCAAAAGTCGAATATGGCTTCGATCAG
CCATGTGTGGCAATGCACGTTTCACCTTGTGGAGAGCATCTAGCCATTCTTGGTCCCCAAGGACGCTTGCTGATC
ATACCATACTTTGAAAGGGTCATTGATCGTCACGTTGAAGACATCACCGACATTATGATCGATATACAATTGAAT
CTCTCTTATTCTAATTCGGAATCGATATATCTCGCTTACGAGCATGGCAGGATTGCAGTCGTGACTTCTTGGGGT
CTTTACATCATCCATCCATCGTTCCCAGCTCCAGACGATTTCTATACTTATCCAGACATCCATGTTCAGAGGGTA
GCAACGTTGAACAACACCAATATCCTACGAGAAGTTTCGTGTCTACAAATGACTGCCACGGCAGTTTGGTTAAAT
TGGCATGTTGAGCTGAACCCAGATGGGTCTGTTTCGAATGATTATCCATCTCAGATCCAAAGTGAAGAGTCGTAT
GAAAGAGGTACTGAAGTGTTTGGTGAGATCCCGAGGTCATCAACTGTTGTTAGCGTTGATTTTGGGTTGGGATCG
TGA
Transcript >AgabiH97|014270
ATGTTACTCAGTCTCCCTTCTGAATTGTTATTGTCTATTCTCCGCCACCTATCACTGCCTGATTTGGCTACGTGC
ATCCTTACTTCCAAAGCTTTCAAGGCTGTTATAGATGACTGTGAATCAACTGTATATCGCCAGGCAGCTGCACAC
CCAAGTTTGCGGTTGATTCCCCACGATGAAGTACTCTTCTCTGAACTCGTACCTCTTGGTCTTGTGTCGAGCCGA
TTTTTGGGCAAGGCAAAGACATGGAAGCAACTTTGTCGCAGAGCTTGTGACGTTCGGCAGAGTTGGCTTGGCAAA
GGACCATCGCGGACCAAAAGCCTCCATAATAATTACCATAACGTGCACCGCATCAAAGTTGATGAAGAACGAGGA
TTTTTTATCACGACTCATGGATCACAGGCCATAGTTCCGTTTGGCGTGTTCAACCCCAATTCGGGCGGGTTGGTA
GTGGCTGATATCACTGACGGCACACCAATATGGATAATGTACTCCCCCCGAATTCGTTCACATGCACATTGCGAA
TATGCCGAGGGCTTCCTTGTTTTCGATCGTTACAACGGTATGAAAGAAATTTGGCGACTTGTCAGCGACGATCTC
AATCTGCGCGCTCCTGAACCTTGCGAGGTAGTGCCCCAGTCACAACCTGATGAGCGTCAACTCAGCCAGGAGCAT
ATAATTTCTGCTCCTGGGAGTCGATTCAAATTTGTTCCACACGCGCTCATCCGTCCGGTTGATGATATTCAAACG
AATGCTTACAGATTGTCTTATCCGACATTACTGTCGGCCGGAGGCGGGTGCCTGTTTCTGTGGGATGTGAGGACA
GGGAAGCTAGTCGAAAGGATGAATGACATTGAGTCACAGTCACCTGCACCGCTTGGTACGCAACATTTAAATCAT
CCAGATGGCGATAACGTGCTTGATGGAATTCGCTACGTCGATGTGAACGACAAGTATGCGTTTGTATGTGGTAGA
CGAAGTATCAAAGCATTTCGACGGCATACTCATCCCGATCCTTCACCGACGGCGACGCAATCAGGTTCATCAGAT
GGGTCGCCAACTGCTTGTTGTGTGATGGCACTTTTCCAATCCGATCTCCAACGTGAAGGGAAATGGGCGTATGAG
GCCCAATACGTCGAAGAATATGAATTGCCTCTAGGAATTTCACTCCCCGCATCTCCCGAATCCGAAGCCAGTACA
GTAGACTGGTTGGAAGATTCTCACGACGAGATACCCAATGAGGGTGACAATAGATGGGTTACTGAGAGTGACGAA
GAGGAGAGAGAAGAAAATCCGGGTGACGAACAAATCTATCTTGCTCCCGGTAGATGGCGACACCCCGAAAAAGTG
GTAGTGAGGCACATATTGGCTTTCACTTCTCTACCTGTGACACCAAGGCCAAAAGTCGAATATGGCTTCGATCAG
CCATGTGTGGCAATGCACGTTTCACCTTGTGGAGAGCATCTAGCCATTCTTGGTCCCCAAGGACGCTTGCTGATC
ATACCATACTTTGAAAGGGTCATTGATCGTCACGTTGAAGACATCACCGACATTATGATCGATATACAATTGAAT
CTCTCTTATTCTAATTCGGAATCGATATATCTCGCTTACGAGCATGGCAGGATTGCAGTCGTGACTTCTTGGGGT
CTTTACATCATCCATCCATCGTTCCCAGCTCCAGACGATTTCTATACTTATCCAGACATCCATGTTCAGAGGGTA
GCAACGTTGAACAACACCAATATCCTACGAGAAGTTTCGTGTCTACAAATGACTGCCACGGCAGTTTGGTTAAAT
TGGCATGTTGAGCTGAACCCAGATGGGTCTGTTTCGAATGATTATCCATCTCAGATCCAAAGTGAAGAGTCGTAT
GAAAGAGGTACTGAAGTGTTTGGTGAGATCCCGAGGTCATCAACTGTTGTTAGCGTTGATTTTGGGTTGGGATCG
TGA
Gene >AgabiH97|014270
ATGTTACTCAGTCTCCCTTCTGAATTGTTATTGTCTATTCTCCGCCACCTATCACTGCCTGATTTGGCTACGTGC
ATCCTTACTTCCAAAGCTTTCAAGGCTGTTATAGATGACTGTGAATCAACTGTATATCGCCAGGCAGCTGCACAC
CCAAGTTTGCGGTTGATTCCCCACGATGAAGTACTCTTCTCTGAACTCGTACCTCTTGGTCTTGTGTCGAGCCGA
TTTTTGGGCAAGGCAAAGACATGGAAGCAACTTTGTGAGTAGCCCCTGCTGGTGCTGTCATTTCAACCCATTGAA
TTATCCAGGTCGCAGAGCTTGTGACGTTCGGCAGAGTTGGCTTGGCAAAGGACCATCGCGGACCAAAAGCCTCCA
TAATAATTACCATAACGTGCACCGCATCAAAGTTGATGAAGAACGAGGATTTTTTATCACGACTCATGGATCACA
GGCCATAGTTCCGTTTGGCGTGTTCAACCCCAATTCGGGCGGGTTGGTAGTGGCTGATATCACTGACGGCACACC
AATATGGATAATGTACTCCGTGAGTATCCAGTTTAACCCATCCACTGTGTTTTGATTTCTGATTAAAAACTTCGA
CCCAGCCCCGAATTCGTTCACATGCACATTGCGAATATGCCGAGGGCTTCCTTGTTTTCGATCGTTACAACGGTA
TGAAAGAAATTTGGCGACTTGTCAGCGACGATCTCAATCTGCGCGCTCCTGAACCTTGCGAGGTAGTGCCCCAGT
CACAACCTGATGAGCGTCAACTCAGCCAGGAGCATATAATTTCTGCTCCTGGGAGTCGATTCAAATTTGTTCCAC
ACGCGCTCATCCGTCCGGTTGATGATATTCAAACGAATGCTTACAGATTGTCTTATCCGACATTACTGTCGGCCG
GAGGCGGGTGCCTGTTTCTGTGGGATGTGAGGACAGGGAAGCTAGTCGAAAGGATGAATGACATTGAGTCACAGT
CACCTGCACCGCTTGGTACGCAACATTTAAATCATCCAGATGGCGATAACGTGCTTGATGGAATTCGCTACGTCG
ATGTGAACGACAAGTATGCGTTTGTATGTGGTAGACGAAGTATCAAAGCATTTCGACGGCATACTCATCCCGATC
CTTCACCGACGGCGACGCAATCAGGTTCATCAGATGGGTCGCCAACTGCTTGTTGTGTGATGGCACTTTTCCAAT
CCGATCTCCAACGTGAAGGGAAATGGGCGTATGAGGCCCAATACGTCGAAGAATATGAATTGCCTCTAGGAATTT
CACTCCCCGCATCTCCCGAATCCGAAGCCAGTACAGTAGACTGGTTGGAAGATTCTCACGACGAGATACCCAATG
AGGGTGACAATAGATGGGTTACTGAGAGTGACGAAGAGGAGAGAGAAGAAAATCCGGGTGACGAACAAATCTATC
TTGCTCCCGGTAGATGGCGACACCCCGAAAAAGTGGTAGTGAGGCACATATTGGCTTTCACTTCTCTACCTGTGA
CACCAAGGCCAAAAGTCGAATATGGCTTCGATCAGCCATGTGTGGCAAGTCAGCATGCTCATTCATAAACGACTT
GAATCTTCGACGCTGATCTTCATTTCAGTGCACGTTTCACCTTGTGGAGAGCATCTAGCCATTCTTGGTCCCCAA
GGACGCTTGCTGATCATACCATACTTTGAAAGGGTCATTGATCGTCACGTTGAAGACATCACCGACATTATGATC
GATATACAATTGAATCTCTCTTATTCTAATTCGGAATCGATATATCTCGCTTACGAGCATGGCAGGATTGCAGTC
GTGACTGTACGCCTTTTTCATCCCTTGAATCCTATCGCATCCGTGATTGATCTATGTGTTTTGATATAGTCTTGG
GGTCTTTACATCATCCATCCATCGTTCCCAGCTCCAGACGATTTCTATACTTATCCAGACATCCATGTTCAGAGG
GTAGCAACGTTGAACAACACCAATATCCTACGAGAAGTTTCGTGTCTACAAATGACTGCCACGGCAGTTTGGTTA
AATTGGCATGTTGAGCTGAACCCAGATGGGTCTGTTTCGAATGATTATCCATCTCAGATCCAAAGTGAAGAGTCG
TATGAAAGAGGTACTGAAGTGTTTGGTGAGATCCGTAAGTACGAGCTTTTCATTTTGAATTTGATTACTGATTGT
GAGTAGCGAGGTCATCAACTGTTGTTAGCGTTGATTTTGGGTTGGGATCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail