Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|014010
Gene name
Locationscaffold_1:3333313..3334293
Strand-
Gene length (bp)980
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 8.4E-12 36 279
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.1E-07 35 145
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.4E-08 34 137

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 10 104 1.0E-06
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 10 104 1.0E-06
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 10 104 1.0E-06
sp|P22862|ESTE_PSEFL Arylesterase OS=Pseudomonas fluorescens PE=1 SV=4 10 286 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|014010
MTKDLEVNTSRFVKSADGTEIYADAAGNRSPSTPVLVLVHGGFLCKDAFNPIFDDPKWTSNLFLVRYDARGHGRS
GKPATEEAWESKRFSEDFEAVCREFEVKEAYVLGWSVGAAVLADITAYTTPVKMLGFINVAGLIYVNPSVNSRVG
SRQSREWGPPFLFPPSEDALQESCAYFLRICSEELSPELFRILLEGMLMQSRGIAKRVCSRKQNPEKMLQEARDG
RIPLLAISGLKDQALITEKLKGELEDLGWKRMTYRYLQDADHMPWVSCAEEFREIVLAWIKELTP*
Coding >AgabiH97|014010
ATGACCAAAGACTTGGAAGTAAATACCTCTCGCTTCGTAAAATCAGCCGATGGCACGGAAATCTATGCTGACGCG
GCAGGAAATCGCTCGCCAAGCACCCCAGTCCTCGTTTTGGTCCATGGTGGTTTCTTGTGCAAAGACGCATTCAAT
CCTATCTTCGACGATCCTAAATGGACCTCTAATCTATTCTTAGTGCGGTACGATGCCCGTGGACACGGTAGAAGC
GGCAAACCGGCCACTGAGGAAGCCTGGGAATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGTAGAGAATTC
GAAGTGAAAGAAGCATATGTCTTGGGATGGAGTGTCGGCGCCGCAGTGCTCGCTGATATCACGGCCTACACCACT
CCAGTTAAAATGCTTGGCTTCATTAATGTCGCAGGACTTATATACGTGAATCCCTCGGTCAATTCACGCGTAGGT
AGTCGACAGTCACGTGAATGGGGACCCCCATTCTTGTTCCCTCCTTCCGAAGATGCCCTCCAAGAATCTTGTGCT
TATTTCCTTCGAATATGCTCCGAAGAACTCTCCCCAGAGCTCTTTCGCATTTTATTGGAAGGAATGCTCATGCAG
TCGCGCGGAATAGCGAAGCGGGTTTGTTCAAGAAAACAGAATCCTGAGAAGATGTTGCAGGAGGCGCGAGACGGG
AGAATTCCACTCCTGGCCATCAGCGGCTTAAAAGACCAAGCATTGATTACTGAGAAGTTGAAAGGAGAGTTGGAA
GACTTGGGATGGAAAAGGATGACCTATCGGTATTTACAAGACGCGGACCACATGCCTTGGGTGTCTTGTGCAGAA
GAGTTTAGAGAAATTGTGTTGGCGTGGATAAAGGAGTTAACACCATAA
Transcript >AgabiH97|014010
ATGACCAAAGACTTGGAAGTAAATACCTCTCGCTTCGTAAAATCAGCCGATGGCACGGAAATCTATGCTGACGCG
GCAGGAAATCGCTCGCCAAGCACCCCAGTCCTCGTTTTGGTCCATGGTGGTTTCTTGTGCAAAGACGCATTCAAT
CCTATCTTCGACGATCCTAAATGGACCTCTAATCTATTCTTAGTGCGGTACGATGCCCGTGGACACGGTAGAAGC
GGCAAACCGGCCACTGAGGAAGCCTGGGAATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGTAGAGAATTC
GAAGTGAAAGAAGCATATGTCTTGGGATGGAGTGTCGGCGCCGCAGTGCTCGCTGATATCACGGCCTACACCACT
CCAGTTAAAATGCTTGGCTTCATTAATGTCGCAGGACTTATATACGTGAATCCCTCGGTCAATTCACGCGTAGGT
AGTCGACAGTCACGTGAATGGGGACCCCCATTCTTGTTCCCTCCTTCCGAAGATGCCCTCCAAGAATCTTGTGCT
TATTTCCTTCGAATATGCTCCGAAGAACTCTCCCCAGAGCTCTTTCGCATTTTATTGGAAGGAATGCTCATGCAG
TCGCGCGGAATAGCGAAGCGGGTTTGTTCAAGAAAACAGAATCCTGAGAAGATGTTGCAGGAGGCGCGAGACGGG
AGAATTCCACTCCTGGCCATCAGCGGCTTAAAAGACCAAGCATTGATTACTGAGAAGTTGAAAGGAGAGTTGGAA
GACTTGGGATGGAAAAGGATGACCTATCGGTATTTACAAGACGCGGACCACATGCCTTGGGTGTCTTGTGCAGAA
GAGTTTAGAGAAATTGTGTTGGCGTGGATAAAGGAGTTAACACCATAA
Gene >AgabiH97|014010
ATGACCAAAGACTTGGAAGTAAATACCTCTCGCTTCGTAAAATCAGCCGATGGCACGGAAATCTATGCTGACGCG
GCAGGAAATCGCTCGCCAAGCACCCCAGTCCTCGTTTTGGTCCATGGTGGTTTCTTGTGCAAAGACGCATTCAAT
CCTATCTTCGACGATCCTAAATGGACCTCTAATCTATTCTTAGTAAGCCAAGTTGGCAGCTTTGTGAACTTGACC
GAAACTCATGATAGTGACAGGTGCGGTACGATGCCCGTGGACACGGTAGAAGCGGCAAACCGGCCACTGAGGAAG
CCTGGGAATCCAAACGGTTTTCGGAAGATTTTGAAGCTGTTTGTAGAGAATTCGAAGTGAAAGAAGCATATGTCT
TGGGATGGAGTGTCGGCGGTGCGCCATTTTCTTTACTCGATACCACTAGACGCGGCTCTGATGACTTTTCAGCCG
CAGTGCTCGCTGATATCACGGCCTACACCACTCCAGTTAAAATGCTTGGCTTCATTAATGTCGCAGGACTTATAT
ACGTGAATCCCTCGGTCAATTCACGCGTAGGTAGTCGACAGTCACGTGAATGGGGACCCCCATTCTTGTTCCCTC
CTTCCGAAGATGCCCTCCAAGAATCTTGTGCTTATTTCCTTCGAATATGCTCCGAAGAACTCTCCCCAGAGCTCT
TTCGCATTTTATTGGAAGGAATGCTCATGCAGTCGCGCGGAATAGCGAAGCGGGTTTGTTCAAGAAAACAGAATC
CTGAGAAGATGTTGCAGGAGGCGCGAGACGGGAGAATTCCACTCCTGGCCATCAGCGGCTTAAAAGACCAAGCAT
TGATTACTGAGAAGTTGAAAGGAGAGTTGGAAGACTTGGGATGGAAAAGGATGACCTATCGGTATTTACAAGACG
CGGACCACATGCCTTGGGTGTCTTGTGCAGAAGAGTTTAGAGAAATTGTGTTGGCGTGGATAAAGGAGTTAACAC
CATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail