Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013930
Gene name
Locationscaffold_1:3313278..3314287
Strand+
Gene length (bp)1009
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05042 Caleosin Caleosin related protein 2.2E-70 77 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SQ57|PXG_SESIN Peroxygenase OS=Sesamum indicum GN=SOP1 PE=1 SV=1 69 241 9.0E-40
sp|O22788|PXG3_ARATH Probable peroxygenase 3 OS=Arabidopsis thaliana GN=PXG3 PE=1 SV=1 79 248 1.0E-39
sp|G1JSL4|PXG1_AVESA Peroxygenase 1 OS=Avena sativa PE=1 SV=1 77 251 1.0E-38
sp|Q9FLN9|PXG2_ARATH Peroxygenase 2 OS=Arabidopsis thaliana GN=PXG2 PE=1 SV=1 76 241 3.0E-38
sp|O81270|PXG1_ARATH Peroxygenase 1 OS=Arabidopsis thaliana GN=PXG1 PE=1 SV=1 72 241 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SQ57|PXG_SESIN Peroxygenase OS=Sesamum indicum GN=SOP1 PE=1 SV=1 69 241 9.0E-40
sp|O22788|PXG3_ARATH Probable peroxygenase 3 OS=Arabidopsis thaliana GN=PXG3 PE=1 SV=1 79 248 1.0E-39
sp|G1JSL4|PXG1_AVESA Peroxygenase 1 OS=Avena sativa PE=1 SV=1 77 251 1.0E-38
sp|Q9FLN9|PXG2_ARATH Peroxygenase 2 OS=Arabidopsis thaliana GN=PXG2 PE=1 SV=1 76 241 3.0E-38
sp|O81270|PXG1_ARATH Peroxygenase 1 OS=Arabidopsis thaliana GN=PXG1 PE=1 SV=1 72 241 2.0E-37
sp|Q7FAX1|PXG_ORYSJ Peroxygenase OS=Oryza sativa subsp. japonica GN=PXG PE=2 SV=1 79 248 6.0E-35
sp|A2XVG1|PXG_ORYSI Peroxygenase OS=Oryza sativa subsp. indica GN=PXG PE=1 SV=1 79 248 6.0E-35
sp|Q9CAB7|PXG4_ARATH Probable peroxygenase 4 OS=Arabidopsis thaliana GN=PXG4 PE=1 SV=1 62 253 1.0E-33
sp|B3H7A9|PXG7_ARATH Probable peroxygenase 7 OS=Arabidopsis thaliana GN=PXG7 PE=2 SV=1 79 244 5.0E-31
sp|Q9CAB8|PXG5_ARATH Probable peroxygenase 5 OS=Arabidopsis thaliana GN=PXG5 PE=2 SV=1 81 251 3.0E-24
sp|F4I4P8|PXGL_ARATH Probable inactive peroxygenase-like protein OS=Arabidopsis thaliana GN=At1g23250 PE=3 SV=1 156 244 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 110 132 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013930
MKLESRPRCLCIGNKEPVVLADLIHRDVISPYVQSIYAPRDKQPHISSPFRKKRKYDMGAPADGCSTAPGYAPGA
NNNTALQNHVAFFDRDSDGIIWPTDTFYGLREINFNLFWTIVAVIVIHGGFSYVAWGTWIPDPFFRLKVRNMHRA
KHGSDTESYTTTGEFDEKRFNYIFNMYSQPPHNALSFREGVHMLHGNMDAFDPFGWSAALFEWWASYYLIWPKDG
YVSKADVRAIYDGSIFYKIAGRKTPKDSN*
Coding >AgabiH97|013930
ATGAAACTTGAATCCCGTCCCCGGTGTTTGTGCATTGGGAACAAGGAGCCAGTGGTGTTGGCCGATTTGATTCAT
CGTGACGTCATTTCCCCATATGTGCAGTCTATATATGCCCCCCGCGACAAACAACCTCACATCTCCTCTCCCTTC
AGAAAGAAAAGAAAATACGATATGGGTGCACCTGCAGACGGATGTTCGACCGCGCCAGGGTATGCTCCCGGAGCT
AACAACAATACCGCACTCCAGAATCATGTTGCCTTTTTCGACCGCGACTCTGATGGTATCATCTGGCCAACTGAT
ACGTTCTATGGTCTCAGGGAAATCAACTTCAATTTATTCTGGACCATTGTTGCGGTAATCGTCATTCATGGAGGA
TTCTCTTATGTGGCATGGGGAACTTGGATTCCGGACCCGTTTTTCCGATTGAAAGTCCGTAATATGCACCGAGCG
AAACACGGTTCCGACACGGAGTCGTACACGACCACAGGAGAATTTGATGAGAAAAGATTCAACTACATCTTTAAT
ATGTATTCTCAACCACCGCACAATGCGCTTTCTTTTCGAGAGGGCGTACATATGCTTCATGGAAACATGGACGCA
TTTGATCCGTTCGGTTGGTCCGCAGCTCTGTTTGAGTGGTGGGCTTCTTATTATTTGATATGGCCGAAGGATGGA
TATGTGAGCAAAGCTGACGTTCGTGCAATCTATGATGGATCCATCTTCTACAAGATTGCTGGACGAAAGACTCCT
AAAGACTCGAATTAG
Transcript >AgabiH97|013930
ATGAAACTTGAATCCCGTCCCCGGTGTTTGTGCATTGGGAACAAGGAGCCAGTGGTGTTGGCCGATTTGATTCAT
CGTGACGTCATTTCCCCATATGTGCAGTCTATATATGCCCCCCGCGACAAACAACCTCACATCTCCTCTCCCTTC
AGAAAGAAAAGAAAATACGATATGGGTGCACCTGCAGACGGATGTTCGACCGCGCCAGGGTATGCTCCCGGAGCT
AACAACAATACCGCACTCCAGAATCATGTTGCCTTTTTCGACCGCGACTCTGATGGTATCATCTGGCCAACTGAT
ACGTTCTATGGTCTCAGGGAAATCAACTTCAATTTATTCTGGACCATTGTTGCGGTAATCGTCATTCATGGAGGA
TTCTCTTATGTGGCATGGGGAACTTGGATTCCGGACCCGTTTTTCCGATTGAAAGTCCGTAATATGCACCGAGCG
AAACACGGTTCCGACACGGAGTCGTACACGACCACAGGAGAATTTGATGAGAAAAGATTCAACTACATCTTTAAT
ATGTATTCTCAACCACCGCACAATGCGCTTTCTTTTCGAGAGGGCGTACATATGCTTCATGGAAACATGGACGCA
TTTGATCCGTTCGGTTGGTCCGCAGCTCTGTTTGAGTGGTGGGCTTCTTATTATTTGATATGGCCGAAGGATGGA
TATGTGAGCAAAGCTGACGTTCGTGCAATCTATGATGGATCCATCTTCTACAAGATTGCTGGACGAAAGACTCCT
AAAGACTCGAATTAG
Gene >AgabiH97|013930
ATGAAACTTGAATCCCGTCCCCGGTGTTTGTGCATTGGGAACAAGGAGCCAGTGGTGTTGGCCGATTTGATTCAT
CGTGACGTCATTTCCCCATATGTGCAGTCTATATATGCCCCCCGCGACAAACAACCTCACATCTCCTCTCCCTTC
AGAAAGAAAAGAAAATACGATATGGGTGCACCTGCAGACGGATGTTCGACCGCGCCAGGGTATGCTCCCGGAGCT
AACAACAATACCGCACTCCAGAATCATGTTGCCTTTTTCGACCGCGACTCTGATGGTATCATCTGGCCAACTGAT
ACGTGAGTGAGACTATCAAACCCAAGGTTCACAGCTACAGGCAAACTCATCATAAATATTTCGATAGGTTCTATG
GTCTCAGGGAAATCAACTTCAATTTATTCTGGACCATTGTTGCGGTAATCGTCATTCATGGAGGATTCTCTTATG
TGGCATGGGGAACTTGGATTCCGGACCCGTTTTTCCGATTGAAAGTCCGTAATATGCACCGAGTAAGTCAAAGAA
AATACCTTTCACGAAATAACAACTTTGAATAAAACCCAAAGGCGAAACACGGTTCCGACACGGAGTCGTACACGA
CCACAGGAGAATTTGATGAGAAAAGATTCAACTACATCTTTAATATGTATTCTCAACCACCGCACAATGCGCTTT
CTTTTCGAGAGGGCGTACATATGCTTCATGGAAACATGGACGCATTTGATCCGGTCGGTGATTCATCAAGCTTGT
GAAATAACAATTGCTCATTTACGCTTTTTCCTCTCTTCAGTTCGGTTGGTCCGCAGCTCTGTTTGAGTGGTGGGC
TTCTTATTATTTGATATGGCCGAAGGATGGATATGTGAGCAAAGCTGACGTTCGTGCAATCTATGATGTGAGTTT
TTGCTTGGGTTTCTCCCCCTATCGTATTCGTTCTGACTGCAGGTTATCCATGTAGGGATCCATCTTCTACAAGAT
TGCTGGACGAAAGACTCCTAAAGACTCGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail