Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013760
Gene name
Locationscaffold_1:3269249..3270484
Strand+
Gene length (bp)1235
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 9.1E-25 58 190

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013760
MKASISTVLASFLVPSALFVHAIPTPRGGGDGVVDRSTTTHLYEKRTADGLADVDKLVITFADVLEQLEGGFYKL
ALDKFNASDFEAAGFSDGDVPLQQIQIIQKDEDIHSKVLEGALEAAGASPLTCQFNFDAALYDVGTMLATARVAE
VIGSSAYSGSANLIQDPKVLSLAAAILAIEGSHSTVTNVLSGSGTAVPSPFVIPLNASEVLALVGGFFSGPCDTG
IAPNPALTITNAADLRTGAAVSLNSTAFDSSSQGNLFCQILTGNLTETIPYPLNECTIPYGVSGPTYFWVTDSSD
PLPNDVIDRSTNTHVVAGPAITIIDCDPQALGIIAVEGEVPYTSTYDSYVAEASPTNYVGPYGCWFHGKSCQGTN
*
Coding >AgabiH97|013760
ATGAAGGCCTCTATCTCTACTGTGCTCGCCTCCTTTTTAGTACCTTCTGCACTCTTTGTGCACGCCATACCTACG
CCCCGAGGCGGTGGTGACGGTGTTGTTGACCGGTCTACTACAACCCATCTCTATGAGAAGCGTACGGCTGATGGC
CTTGCTGACGTTGATAAATTGGTTATAACATTTGCTGACGTCCTAGAACAGCTGGAGGGCGGTTTTTACAAGCTG
GCTCTCGACAAGTTCAACGCTTCGGATTTCGAGGCCGCCGGTTTCAGTGATGGTGATGTTCCTCTCCAACAGATC
CAGATCATTCAGAAGGATGAGGATATACATTCCAAAGTCTTGGAGGGTGCTTTGGAGGCTGCTGGAGCAAGTCCT
CTTACCTGCCAATTCAACTTCGACGCCGCGCTCTATGATGTCGGTACCATGCTAGCCACGGCTCGTGTTGCTGAA
GTCATTGGTTCTTCGGCATACTCTGGTTCAGCTAACCTGATTCAGGACCCAAAGGTCTTGAGTTTGGCTGCTGCC
ATCTTGGCGATCGAGGGAAGCCATTCTACTGTCACGAACGTTCTTTCTGGTTCCGGGACTGCCGTTCCTTCTCCC
TTCGTCATTCCTCTCAATGCCAGCGAAGTTCTTGCCCTTGTAGGGGGATTCTTCTCCGGCCCATGTGATACGGGC
ATCGCCCCTAACCCGGCTTTGACTATCACGAACGCAGCAGATTTAAGAACAGGAGCTGCGGTCAGCTTGAATTCG
ACTGCATTCGACAGCTCATCGCAAGGGAATCTTTTCTGTCAGATCTTGACTGGCAATTTAACTGAGACGATTCCT
TATCCCCTGAACGAATGCACTATTCCGTACGGAGTTTCAGGCCCGACATATTTCTGGGTCACAGACAGTAGTGAC
CCTCTTCCCAACGATGTTATCGACCGCTCTACGAACACGCACGTAGTTGCGGGACCTGCCATCACCATCATTGAT
TGTGATCCTCAAGCTCTTGGTATCATCGCTGTCGAGGGCGAAGTTCCTTATACAAGTACCTATGACTCGTACGTT
GCTGAAGCTTCGCCAACGAACTATGTTGGTCCTTACGGCTGCTGGTTCCACGGGAAATCGTGCCAAGGGACAAAT
TGA
Transcript >AgabiH97|013760
ATGAAGGCCTCTATCTCTACTGTGCTCGCCTCCTTTTTAGTACCTTCTGCACTCTTTGTGCACGCCATACCTACG
CCCCGAGGCGGTGGTGACGGTGTTGTTGACCGGTCTACTACAACCCATCTCTATGAGAAGCGTACGGCTGATGGC
CTTGCTGACGTTGATAAATTGGTTATAACATTTGCTGACGTCCTAGAACAGCTGGAGGGCGGTTTTTACAAGCTG
GCTCTCGACAAGTTCAACGCTTCGGATTTCGAGGCCGCCGGTTTCAGTGATGGTGATGTTCCTCTCCAACAGATC
CAGATCATTCAGAAGGATGAGGATATACATTCCAAAGTCTTGGAGGGTGCTTTGGAGGCTGCTGGAGCAAGTCCT
CTTACCTGCCAATTCAACTTCGACGCCGCGCTCTATGATGTCGGTACCATGCTAGCCACGGCTCGTGTTGCTGAA
GTCATTGGTTCTTCGGCATACTCTGGTTCAGCTAACCTGATTCAGGACCCAAAGGTCTTGAGTTTGGCTGCTGCC
ATCTTGGCGATCGAGGGAAGCCATTCTACTGTCACGAACGTTCTTTCTGGTTCCGGGACTGCCGTTCCTTCTCCC
TTCGTCATTCCTCTCAATGCCAGCGAAGTTCTTGCCCTTGTAGGGGGATTCTTCTCCGGCCCATGTGATACGGGC
ATCGCCCCTAACCCGGCTTTGACTATCACGAACGCAGCAGATTTAAGAACAGGAGCTGCGGTCAGCTTGAATTCG
ACTGCATTCGACAGCTCATCGCAAGGGAATCTTTTCTGTCAGATCTTGACTGGCAATTTAACTGAGACGATTCCT
TATCCCCTGAACGAATGCACTATTCCGTACGGAGTTTCAGGCCCGACATATTTCTGGGTCACAGACAGTAGTGAC
CCTCTTCCCAACGATGTTATCGACCGCTCTACGAACACGCACGTAGTTGCGGGACCTGCCATCACCATCATTGAT
TGTGATCCTCAAGCTCTTGGTATCATCGCTGTCGAGGGCGAAGTTCCTTATACAAGTACCTATGACTCGTACGTT
GCTGAAGCTTCGCCAACGAACTATGTTGGTCCTTACGGCTGCTGGTTCCACGGGAAATCGTGCCAAGGGACAAAT
TGA
Gene >AgabiH97|013760
ATGAAGGCCTCTATCTCTACTGTGCTCGCCTCCTTTTTAGTACCTTCTGCACTCTTTGTGCACGCCATACCTACG
CCCCGAGGCGGTGGTGACGGTGTTGTTGACCGGTCTACTACAACCCATCTCTATGAGAAGCGTACGGCTGATGGC
CTTGCTGACGTTGATAAATTGGTTATAAGTGCGTTTCACGCACAATGCATTCTTGACAGTTATCTAACCTCTGTT
GCTCCCACTTAGCATTTGCTGACGTCCTAGAACAGCTGGAGGGCGGTTTTTACAAGCTGGCTCTCGACAAGTTCA
ACGCTTCGGATTTCGAGGCCGCCGGTTTCAGTGATGGTGATGTTCCTCTCCAACAGATCCAGATCATTCAGAAGG
ATGAGGATATACATTCCAAAGTCTTGGAGGGTGCTTTGGAGGCTGCTGGAGCAAGTCCTCTTACCTGCCAATTCA
ACTTCGACGCCGCGCTCTATGATGTCGGTACCATGCTAGCCACGGCTCGTGTTGCTGAAGTCATTGGTTCTTCGG
CATACTCTGGTTCAGCTAACCTGATTCAGGACCCAAAGGTCTTGAGTTTGGCTGCTGCCATCTTGGCGATCGAGG
GAAGCCATTCTACTGTCACGAACGTTCTTTCTGGTTCCGGGACTGCCGTTCCTTCTCCCTTCGTCATTCCTCTCA
ATGCCAGCGAAGTTCTTGCCCTTGTAGGGGGATTCTTCTCCGGCCCATGTGATACGGGCATCGCCCCTAACCCGG
CTTTGACTATCACGAACGCAGCAGATTTAAGAACAGGAGCTGCGGTCAGCTTGAATTCGACTGCATTCGACAGCT
CATCGCAAGTGAGTATTTTTTGACATTGTGAATGATCATTGCTGACTTCAGTCTAGGGGAATCTTTTCTGTCAGA
TCTTGACTGGCAATTTAACTGAGACGATTCCTTATCCCCTGAACGAATGCACTATTCCGTACGGAGTTTCAGGCC
CGACATATTTCTGGGTCACAGACAGTAGTGACCCTCTTCCCAACGATGTTATCGACCGCTCTACGAACACGCACG
TAGTTGCGGGACCTGCCATCACCATCATTGATTGTGATCCTCAAGCTCTTGGTATCATCGCTGTCGAGGGCGAAG
TTCCTTATACAAGTACCTATGACTCGTACGTTGCTGAAGCTTCGCCAACGAACTATGTTGGTCCTTACGGCTGCT
GGTTCCACGGGAAATCGTGCCAAGGGACAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail