Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013640
Gene name
Locationscaffold_1:3241115..3241486
Strand-
Gene length (bp)371
Transcript length (bp)264
Coding sequence length (bp)264
Protein length (aa) 88

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1171 0.161 0.9251 0.1457 0.141 0.0752 0.1167 0.1619 0.1403 0.0146

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup13143
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|227000
Agaricus bisporus var bisporus H97 AgabiH97|013640 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013640
MPVMIYAAPQLDILQGLTGGGVSGVGSLNGGLAPVSNTISGGGIGALGDITGTVTRGGLLGRSQNAAEKLEGLGG
SDHWNDFFVQGC*
Coding >AgabiH97|013640
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGCTGACTGGTGGAGGAGTATCTGGAGTT
GGCTCATTGAATGGAGGGCTCGCACCGGTTTCAAACACCATCAGTGGTGGAGGTATTGGGGCCCTTGGGGACATC
ACAGGCACTGTTACTCGTGGTGGTCTTCTCGGACGATCCCAAAATGCCGCTGAAAAGTTGGAGGGTCTTGGTGGA
AGCGATCACTGGAACGATTTTTTTGTGCAAGGCTGTTGA
Transcript >AgabiH97|013640
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGCTGACTGGTGGAGGAGTATCTGGAGTT
GGCTCATTGAATGGAGGGCTCGCACCGGTTTCAAACACCATCAGTGGTGGAGGTATTGGGGCCCTTGGGGACATC
ACAGGCACTGTTACTCGTGGTGGTCTTCTCGGACGATCCCAAAATGCCGCTGAAAAGTTGGAGGGTCTTGGTGGA
AGCGATCACTGGAACGATTTTTTTGTGCAAGGCTGTTGA
Gene >AgabiH97|013640
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGCTGACTGGTGGAGGAGTATCTGGAGTT
GGCTCATTGAATGGAGGGCTCGCACCGGTTTCAAACACCATCAGTGGTGGAGGTATTGGGGCCCTTGGGGACATC
ACAGGCACTGTTACTCGTGGTGGTCTTCTCGGACGATCCCAAAATGCCGCTGAAAAGTTGGAGGGTCTTGGTGGA
AGCGATCGTACCTAGGGTCACAACTGCAGAGGGTAAATCCATGGTTTAGACTGGAAGTATGTCTTTCCTTTTCAT
CTACGATTCTCATTAGTAACTTACGATTCGTCTCTGGTATTAACAGCGATTTTTTTGTGCAAGGCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail