Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013520
Gene name
Locationscaffold_1:3212900..3214789
Strand-
Gene length (bp)1889
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01619 Pro_dh Proline dehydrogenase 1.6E-49 65 472

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86H28|PROD_DICDI Proline dehydrogenase 1, mitochondrial OS=Dictyostelium discoideum GN=prodh PE=3 SV=1 14 478 8.0E-28
sp|Q2V057|PROD2_RAT Probable proline dehydrogenase 2 OS=Rattus norvegicus GN=Prodh2 PE=2 SV=1 10 491 4.0E-26
sp|Q8VCZ9|PROD2_MOUSE Probable proline dehydrogenase 2 OS=Mus musculus GN=Prodh2 PE=1 SV=1 10 491 5.0E-26
sp|A6QQ74|PROD2_BOVIN Probable proline dehydrogenase 2 OS=Bos taurus GN=PRODH2 PE=2 SV=1 10 479 1.0E-23
sp|Q6NKX1|PROD2_ARATH Proline dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=POX2 PE=2 SV=1 1 491 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86H28|PROD_DICDI Proline dehydrogenase 1, mitochondrial OS=Dictyostelium discoideum GN=prodh PE=3 SV=1 14 478 8.0E-28
sp|Q2V057|PROD2_RAT Probable proline dehydrogenase 2 OS=Rattus norvegicus GN=Prodh2 PE=2 SV=1 10 491 4.0E-26
sp|Q8VCZ9|PROD2_MOUSE Probable proline dehydrogenase 2 OS=Mus musculus GN=Prodh2 PE=1 SV=1 10 491 5.0E-26
sp|A6QQ74|PROD2_BOVIN Probable proline dehydrogenase 2 OS=Bos taurus GN=PRODH2 PE=2 SV=1 10 479 1.0E-23
sp|Q6NKX1|PROD2_ARATH Proline dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=POX2 PE=2 SV=1 1 491 1.0E-23
sp|P92983|PROD1_ARATH Proline dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=POX1 PE=1 SV=2 1 495 3.0E-23
sp|Q9WU79|PROD_MOUSE Proline dehydrogenase 1, mitochondrial OS=Mus musculus GN=Prodh PE=1 SV=2 155 491 4.0E-23
sp|Q04499|PROD_DROME Proline dehydrogenase 1, mitochondrial OS=Drosophila melanogaster GN=slgA PE=1 SV=2 161 486 7.0E-23
sp|O43272|PROD_HUMAN Proline dehydrogenase 1, mitochondrial OS=Homo sapiens GN=PRODH PE=1 SV=3 118 471 4.0E-22
sp|Q9UF12|PROD2_HUMAN Probable proline dehydrogenase 2 OS=Homo sapiens GN=PRODH2 PE=2 SV=1 10 491 8.0E-22
sp|Q148G5|PROD_BOVIN Proline dehydrogenase 1, mitochondrial OS=Bos taurus GN=PRODH PE=2 SV=1 155 491 3.0E-21
sp|Q6PAY6|PROD2_XENLA Probable proline dehydrogenase 2 OS=Xenopus laevis GN=prodh2 PE=2 SV=1 8 314 6.0E-20
sp|O74524|PROD_SCHPO Probable proline dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.03c PE=3 SV=1 14 491 1.0E-19
sp|O45228|PROD_CAEEL Proline dehydrogenase 1, mitochondrial OS=Caenorhabditis elegans GN=B0513.5 PE=3 SV=2 155 333 9.0E-15
sp|Q9XB58|CARD_PECCC Carbapenem antibiotics biosynthesis protein CarD OS=Pectobacterium carotovorum subsp. carotovorum GN=carD PE=3 SV=1 115 467 2.0E-13
sp|O45228|PROD_CAEEL Proline dehydrogenase 1, mitochondrial OS=Caenorhabditis elegans GN=B0513.5 PE=3 SV=2 415 492 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013520
MLSSPCVRDITEAFVRTTFFGHFVGGDTAEGTLPLLRAFRRANKGAILAYSVEVDPSSVPSHTSNEISKDKLSQK
QLIKEIIHSIDVAASFEDALNGGRRTWVALKLTALLPNAQALTNLSKHIVQSRALEPDQVPFPGCPRSSDLDVIL
APTSLTPLTEKDTADLRELYSDIHRVCEHAQTRGVKIIIDAEWSWYEPAICAIALALMREFNTLSNHQSTMQPLI
YTTFQAYLRRTPSHLALALADARRNNYSLGVKLVRGAYHPYEIAAHKSKETSMSISPDELPPVWEKKEETDRCYD
NCVKVLINGVREDLSNRQDVHTLRSSEDNLRLAEASRSETIKGPISHPIRDLLPAVGPDSKKIPSIGILFGTHNW
ESSKLILRELERNGLAESLPEEPRPDDGATVIRVKPEVVERVAIGQLFGMSDDLTQYLVDRTRTTTPFIIKYVPY
GGLREVMPYLSRRAVENKSVLGEGKTAEERRRAGRALWKRITFQI*
Coding >AgabiH97|013520
ATGCTGTCTTCACCATGTGTTCGTGATATCACAGAGGCGTTCGTTAGAACAACGTTCTTCGGTCATTTCGTTGGC
GGTGATACTGCGGAAGGCACTTTGCCCCTTTTACGTGCCTTCCGCAGGGCCAACAAAGGCGCCATCCTCGCCTAC
TCGGTCGAAGTCGATCCCTCTTCTGTTCCTTCACATACGAGTAATGAAATCTCTAAGGATAAACTTTCGCAAAAG
CAGCTGATAAAGGAGATAATCCACTCCATCGATGTCGCTGCTAGTTTTGAAGACGCCTTAAACGGCGGGAGGCGC
ACCTGGGTCGCCCTCAAGTTAACAGCTCTCTTGCCCAATGCTCAGGCTCTCACTAACCTATCCAAGCACATTGTT
CAGTCTCGCGCTCTCGAACCTGACCAAGTTCCATTCCCAGGCTGTCCTCGGTCCTCTGACCTAGATGTAATTTTG
GCCCCCACCTCTCTGACCCCCCTGACCGAGAAGGACACCGCGGATCTGCGTGAGCTATATAGTGATATTCATCGT
GTGTGTGAACATGCACAAACGCGAGGCGTCAAAATCATAATAGATGCTGAGTGGAGTTGGTACGAACCCGCCATT
TGCGCAATCGCCCTCGCGTTGATGCGCGAGTTTAATACTCTTTCCAATCATCAGTCTACAATGCAACCCCTGATC
TACACCACCTTTCAAGCTTATCTCAGGAGAACACCGTCTCATCTAGCCCTCGCTCTCGCTGATGCACGAAGGAAT
AACTACTCGCTAGGTGTCAAACTTGTCAGGGGTGCTTATCATCCCTATGAAATCGCCGCACACAAGTCCAAAGAA
ACTTCTATGTCTATATCACCAGATGAACTCCCGCCAGTATGGGAGAAGAAGGAAGAAACGGACCGATGTTACGAT
AACTGTGTCAAGGTGCTAATAAACGGTGTCCGCGAAGATCTCTCTAATAGGCAAGACGTCCATACTTTGAGAAGT
TCCGAGGATAATTTGAGACTTGCCGAGGCCTCGAGGAGTGAAACAATCAAGGGTCCTATCTCTCACCCAATCAGA
GATCTATTGCCCGCCGTAGGGCCGGATAGCAAGAAAATTCCTTCTATCGGTATTCTATTCGGCACACATAACTGG
GAAAGCTCTAAATTGATACTCCGGGAATTGGAGCGTAACGGTCTCGCGGAATCGCTTCCGGAAGAGCCTAGACCA
GACGACGGCGCAACAGTGATAAGGGTCAAACCTGAAGTCGTGGAGCGTGTGGCCATCGGCCAATTATTTGGTATG
AGTGATGACTTGACTCAATATCTCGTCGATCGTACCAGGACGACAACACCGTTTATCATCAAATATGTTCCATAC
GGAGGCCTCCGCGAAGTAATGCCCTATTTAAGCAGAAGGGCAGTCGAGAACAAATCCGTACTCGGTGAAGGCAAG
ACCGCCGAGGAACGCCGACGAGCCGGTAGGGCCTTATGGAAGAGGATCACTTTCCAAATATGA
Transcript >AgabiH97|013520
ATGCTGTCTTCACCATGTGTTCGTGATATCACAGAGGCGTTCGTTAGAACAACGTTCTTCGGTCATTTCGTTGGC
GGTGATACTGCGGAAGGCACTTTGCCCCTTTTACGTGCCTTCCGCAGGGCCAACAAAGGCGCCATCCTCGCCTAC
TCGGTCGAAGTCGATCCCTCTTCTGTTCCTTCACATACGAGTAATGAAATCTCTAAGGATAAACTTTCGCAAAAG
CAGCTGATAAAGGAGATAATCCACTCCATCGATGTCGCTGCTAGTTTTGAAGACGCCTTAAACGGCGGGAGGCGC
ACCTGGGTCGCCCTCAAGTTAACAGCTCTCTTGCCCAATGCTCAGGCTCTCACTAACCTATCCAAGCACATTGTT
CAGTCTCGCGCTCTCGAACCTGACCAAGTTCCATTCCCAGGCTGTCCTCGGTCCTCTGACCTAGATGTAATTTTG
GCCCCCACCTCTCTGACCCCCCTGACCGAGAAGGACACCGCGGATCTGCGTGAGCTATATAGTGATATTCATCGT
GTGTGTGAACATGCACAAACGCGAGGCGTCAAAATCATAATAGATGCTGAGTGGAGTTGGTACGAACCCGCCATT
TGCGCAATCGCCCTCGCGTTGATGCGCGAGTTTAATACTCTTTCCAATCATCAGTCTACAATGCAACCCCTGATC
TACACCACCTTTCAAGCTTATCTCAGGAGAACACCGTCTCATCTAGCCCTCGCTCTCGCTGATGCACGAAGGAAT
AACTACTCGCTAGGTGTCAAACTTGTCAGGGGTGCTTATCATCCCTATGAAATCGCCGCACACAAGTCCAAAGAA
ACTTCTATGTCTATATCACCAGATGAACTCCCGCCAGTATGGGAGAAGAAGGAAGAAACGGACCGATGTTACGAT
AACTGTGTCAAGGTGCTAATAAACGGTGTCCGCGAAGATCTCTCTAATAGGCAAGACGTCCATACTTTGAGAAGT
TCCGAGGATAATTTGAGACTTGCCGAGGCCTCGAGGAGTGAAACAATCAAGGGTCCTATCTCTCACCCAATCAGA
GATCTATTGCCCGCCGTAGGGCCGGATAGCAAGAAAATTCCTTCTATCGGTATTCTATTCGGCACACATAACTGG
GAAAGCTCTAAATTGATACTCCGGGAATTGGAGCGTAACGGTCTCGCGGAATCGCTTCCGGAAGAGCCTAGACCA
GACGACGGCGCAACAGTGATAAGGGTCAAACCTGAAGTCGTGGAGCGTGTGGCCATCGGCCAATTATTTGGTATG
AGTGATGACTTGACTCAATATCTCGTCGATCGTACCAGGACGACAACACCGTTTATCATCAAATATGTTCCATAC
GGAGGCCTCCGCGAAGTAATGCCCTATTTAAGCAGAAGGGCAGTCGAGAACAAATCCGTACTCGGTGAAGGCAAG
ACCGCCGAGGAACGCCGACGAGCCGGTAGGGCCTTATGGAAGAGGATCACTTTCCAAATATGA
Gene >AgabiH97|013520
ATGCTGTCTTCACCATGTGCTCAATACCACAACTCGTGGAACATTCCCCAAAGATTCTCAGTGTCCTAACCAGTG
TTCCAGGTGTTCGTGATATCACAGAGGCGTTCGTTAGAACAACGTTCTTCGGTCATGTACGTGTCTCCGTGCCCT
CCGGACCCTTAGACTCACAAGAATGCAGTTCGTTGGCGGTGATACTGCGGAAGGCACTTTGCCCCTTTTACGTGC
CTTCCGCAGGGCCAACAAAGGCGCCATCCTCGCCTACTCGGTCGAAGTCGATCCCTCTTCTGTTCCTTCACATAC
GAGTAATGAAATCTCTAAGGATAAACTTTCGCAAAAGCAGCTGATAAAGGAGATAATCCACTCCATCGATGTCGC
TGCTAGTTTTGAAGACGCCTTAAACGGCGGGAGGCGCACCTGGGTCGCCCTCAAGTTAGTAAGTCGGGAACACTT
GTAGTACCTCCCCCTCTCTCTCAACCTCACGCAGACAGCTCTCTTGCCCAATGCTCAGGCTCTCACTAACCTATC
CAAGCACATTGTTCAGTCTCGCGCTCTCGAACCTGACCAAGTTCCATTCCCAGGCTGTCCTCGGTCCTCTGACCT
AGATGTAATTTTGGCCCCCACCTCTCTGACCCCCCTGACCGAGAAGGACACCGCGGATCTGCGTGAGCTATATAG
TGATATTCATCGTGTGTGTGAACATGCACAAACGCGAGGCGTCAAAATCATAATAGATGCTGAGTGGAGGTACGT
GCCCCGTAACATCGCGAGCAAATGTTCTCTGATTAATGACGTCATTATTGTGGGGAAATAGTTGGTACGAACCCG
CCATTTGCGCAATCGCCCTCGCGTTGATGCGCGAGTTTAATACTCTTTCCAATCATCAGTCTACAATGCAACCCC
TGATCTACACCACCTTTCAAGCTTATCTCAGGAGGTCAACTATACCCTTCTCTCGCTTACAAGTAGCTTACCACT
TTCTGTTAGAACACCGTCTCATCTAGCCCTCGCTCTCGCTGATGCACGAAGGAATAACTACTCGCTAGGTGTCAA
ACTTGTCAGGGGTGCTTATCATCCCTATGAAATCGCCGCACACAAGTCCAAAGAAACTTCTATGTCTATATCACC
AGATGAACTCCCGCCAGTATGGGAGAAGAAGGAAGAAACGGACCGATGTTACGATAACTGTGTCAAGGTGCTAAT
AAACGGTGTCCGCGAAGATCTCTCTAATAGGCAAGACGTCCATACTTTGAGAAGTTCCGAGGATAATTTGAGACT
TGCCGAGGCCTCGAGGAGTGAAACAATCAAGGGTCCTATCTCTCACCCAATCAGAGATCTATTGCCCGCCGTAGG
GCCGGATAGCAAGAAAATTCCTTCTATCGGTATTCTATTCGGCACACATAACTGGGAAAGCTCTAAATTGATACT
CCGGGAATTGGAGCGTAACGGTCTCGCGGAATCGCTTCCGGAAGAGCCTAGACCAGACGACGGCGCAACAGTGAT
AAGGGTCAAACCTGAAGTCGTGGAGCGTGTGGCCATCGGCCAATTATTTGGTGGGTGTTTGATTACACATCAATT
TCGCTTTCTATTTTGGCTGATCGTCGATGTCGATTTGATCAGGTATGAGTGATGACTTGACTCAATATCTCGTCG
ATCGTACCAGGACGACAACACCGTTTATCATCAAGTCAGCTTATCTCCATTCATGAGATAACTTGAGCTTACTAT
ATCCGTTCTCTAGATATGTTCCATACGGAGGCCTCCGCGAAGTAATGCCCTATTTAAGCAGAAGGGCAGTCGAGA
ACAAATCCGTACTCGGTGAAGGCAAGACCGCCGAGGAACGCCGACGAGCCGGTAGGGCCTTATGGAAGAGGATCA
CTTTCCAAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail