Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013320
Gene name
Locationscaffold_1:3178191..3180135
Strand+
Gene length (bp)1944
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00665 rve Integrase core domain 1.4E-16 532 628
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.3E-13 96 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 647 9.0E-50
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 88 646 1.0E-33
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 300 646 3.0E-18
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 340 646 5.0E-18
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 340 646 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 647 9.0E-50
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 88 646 1.0E-33
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 300 646 3.0E-18
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 340 646 5.0E-18
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 340 646 5.0E-18
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 340 646 5.0E-18
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 340 646 6.0E-18
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 340 646 6.0E-18
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 340 646 6.0E-18
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 340 646 6.0E-18
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 340 646 6.0E-18
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 340 646 6.0E-18
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 340 646 7.0E-18
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 340 646 8.0E-18
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 400 646 1.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 400 646 2.0E-15
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 400 646 2.0E-15
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 400 646 2.0E-15
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 400 646 2.0E-15
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 400 646 2.0E-15
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 400 646 2.0E-15
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 400 646 2.0E-15
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 400 646 2.0E-15
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 400 646 2.0E-15
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 400 646 2.0E-15
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 400 646 2.0E-15
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 400 646 2.0E-15
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 400 646 2.0E-15
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 400 646 2.0E-15
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 400 646 2.0E-15
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 400 646 2.0E-15
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 400 646 4.0E-15
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 400 646 4.0E-15
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 400 646 4.0E-15
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 400 646 4.0E-15
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 400 646 5.0E-15
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 400 646 5.0E-15
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 400 646 5.0E-15
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 400 646 6.0E-15
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 400 646 6.0E-15
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 400 646 6.0E-15
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 400 646 6.0E-15
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 400 646 6.0E-15
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 400 646 6.0E-15
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 400 646 6.0E-15
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 400 646 1.0E-14
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 506 646 2.0E-12
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 468 647 2.0E-12
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 468 647 2.0E-12
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 468 646 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013320
MSSTTAINDVLPPTVPALEVSGSNWAIFELRFRMVIQGKGLWGHFDGTVPRPTPPRATTPVTRPSTPVPPTSSTA
TAAQVALPSTPAPTTADLDAWDRNKNISLSLLAQRIPDSTLVVVSTQPTVRAMWMKIVQEYTYKSAFSQANLCQD
FMSSRCPIGGDVRLFLNDLRAKKAELLAIGVHITDDEYRSAIIQSLPRWLSTYASNQLSAARLHTSLHNTIDPDL
LIVMICDEWDRTRRFAKKSQKTEGNDALGVETEDKKKGKGKDKAKGKEKKKGPCWICEGDHWKRDCPKRKKEEEN
KEKEKSKPSANAVAEDDDDSLTVDIEEVGKVSEMTEQVEVFDSGSSRHITPYRNSFTTFESITPRTLRAANQQQF
SAVGKGEVNVDVPNGDFVSQIRLKEVLYTPKASYTLISIGRLDDEGFTTTFRDGKCIIRNSEGVRIAEIPRNDKG
LYKLIKGNGDEVNIVTESLTRDALHRRLGHISPIAAEKLVNDELITGIKLIEGKPDVSCDSCAYAKATRQPIAKV
REGERATRVGEEIHTDVWGPARVATKKGRRYYVTFTDDYSRWTHIEFLTNKSDVFDAYKCFEAWCETQFDVRIKV
LHSDRGGEYTSEEFQRYLKSRGTEIKLTVHDTPQHNGVAERRNRTIA*
Coding >AgabiH97|013320
ATGTCAAGTACAACAGCTATAAACGATGTGCTCCCGCCTACAGTGCCTGCATTGGAGGTTTCCGGATCGAACTGG
GCGATTTTCGAGTTGCGATTTCGGATGGTAATCCAAGGGAAGGGCCTGTGGGGTCATTTTGACGGGACAGTTCCT
CGTCCCACACCACCGCGTGCTACTACTCCAGTGACACGTCCCTCTACTCCAGTTCCACCTACTTCTTCCACTGCG
ACTGCAGCACAAGTAGCTTTACCTTCGACACCAGCTCCTACAACGGCCGATCTTGACGCCTGGGATCGAAACAAA
AACATATCCCTCTCGCTCTTGGCCCAGCGTATTCCCGACTCTACACTTGTTGTCGTTTCAACCCAACCTACAGTT
AGAGCAATGTGGATGAAGATAGTACAAGAATATACGTACAAAAGTGCCTTTTCGCAGGCAAACCTTTGTCAAGAC
TTCATGTCTTCGCGTTGCCCAATCGGTGGAGATGTACGCTTGTTCTTGAATGACTTGCGAGCTAAGAAAGCAGAA
TTGTTAGCCATCGGTGTTCATATTACAGATGATGAATACCGAAGTGCGATTATCCAATCATTACCTCGCTGGTTG
TCAACGTACGCTTCGAATCAACTTTCGGCAGCTCGTCTTCACACCTCCCTTCATAACACAATTGATCCCGATCTC
TTGATTGTCATGATCTGTGACGAATGGGACCGTACCCGTCGCTTCGCTAAGAAGAGTCAGAAGACTGAAGGGAAT
GATGCTCTGGGTGTAGAAACAGAAGACAAGAAAAAGGGAAAAGGAAAGGATAAAGCTAAAGGAAAGGAGAAGAAA
AAGGGACCATGTTGGATTTGTGAAGGAGATCACTGGAAGAGAGATTGCCCAAAGCGGAAGAAAGAGGAGGAAAAC
AAAGAGAAGGAGAAGTCAAAACCCAGTGCTAATGCCGTAGCTGAAGACGATGATGACTCGTTGACGGTGGATATT
GAGGAGGTAGGGAAGGTTTCTGAGATGACGGAACAAGTTGAGGTTTTTGACTCAGGGTCTTCTCGGCACATCACT
CCCTATCGTAATTCATTCACCACTTTCGAGTCTATTACGCCTCGCACTCTTCGAGCAGCCAACCAACAACAATTC
AGCGCAGTTGGCAAAGGCGAAGTAAACGTTGACGTACCAAATGGTGACTTTGTATCCCAAATTCGTCTCAAAGAG
GTGTTGTACACACCTAAGGCCAGCTACACTTTGATTTCAATTGGCCGATTGGACGACGAAGGCTTTACGACTACA
TTCCGTGATGGGAAATGTATTATCCGAAACTCGGAGGGTGTTCGTATCGCTGAAATCCCTAGAAATGATAAGGGA
TTATACAAGTTAATCAAAGGCAATGGTGACGAAGTCAATATCGTGACGGAATCACTTACAAGGGATGCTCTTCAC
CGTCGTCTGGGTCATATTTCACCTATCGCCGCTGAGAAACTCGTTAATGACGAACTCATCACTGGTATAAAGCTC
ATTGAAGGGAAACCAGATGTTTCTTGTGATTCATGCGCATATGCAAAGGCTACGAGGCAACCAATCGCTAAAGTT
CGAGAGGGTGAGAGGGCAACTCGAGTAGGAGAGGAGATCCATACAGATGTGTGGGGGCCAGCCAGAGTTGCTACC
AAAAAGGGACGACGTTATTATGTCACTTTTACGGACGACTATTCGAGATGGACTCACATCGAGTTCTTGACGAAC
AAATCCGATGTCTTCGATGCATATAAATGTTTTGAAGCATGGTGCGAAACTCAATTTGATGTTCGTATCAAGGTT
CTGCACTCGGATCGGGGAGGGGAGTATACGTCTGAAGAATTTCAGCGTTATCTCAAATCTCGTGGTACGGAAATA
AAACTTACCGTTCATGACACCCCTCAACATAATGGAGTCGCGGAACGTCGAAATCGTACAATCGCTTGA
Transcript >AgabiH97|013320
ATGTCAAGTACAACAGCTATAAACGATGTGCTCCCGCCTACAGTGCCTGCATTGGAGGTTTCCGGATCGAACTGG
GCGATTTTCGAGTTGCGATTTCGGATGGTAATCCAAGGGAAGGGCCTGTGGGGTCATTTTGACGGGACAGTTCCT
CGTCCCACACCACCGCGTGCTACTACTCCAGTGACACGTCCCTCTACTCCAGTTCCACCTACTTCTTCCACTGCG
ACTGCAGCACAAGTAGCTTTACCTTCGACACCAGCTCCTACAACGGCCGATCTTGACGCCTGGGATCGAAACAAA
AACATATCCCTCTCGCTCTTGGCCCAGCGTATTCCCGACTCTACACTTGTTGTCGTTTCAACCCAACCTACAGTT
AGAGCAATGTGGATGAAGATAGTACAAGAATATACGTACAAAAGTGCCTTTTCGCAGGCAAACCTTTGTCAAGAC
TTCATGTCTTCGCGTTGCCCAATCGGTGGAGATGTACGCTTGTTCTTGAATGACTTGCGAGCTAAGAAAGCAGAA
TTGTTAGCCATCGGTGTTCATATTACAGATGATGAATACCGAAGTGCGATTATCCAATCATTACCTCGCTGGTTG
TCAACGTACGCTTCGAATCAACTTTCGGCAGCTCGTCTTCACACCTCCCTTCATAACACAATTGATCCCGATCTC
TTGATTGTCATGATCTGTGACGAATGGGACCGTACCCGTCGCTTCGCTAAGAAGAGTCAGAAGACTGAAGGGAAT
GATGCTCTGGGTGTAGAAACAGAAGACAAGAAAAAGGGAAAAGGAAAGGATAAAGCTAAAGGAAAGGAGAAGAAA
AAGGGACCATGTTGGATTTGTGAAGGAGATCACTGGAAGAGAGATTGCCCAAAGCGGAAGAAAGAGGAGGAAAAC
AAAGAGAAGGAGAAGTCAAAACCCAGTGCTAATGCCGTAGCTGAAGACGATGATGACTCGTTGACGGTGGATATT
GAGGAGGTAGGGAAGGTTTCTGAGATGACGGAACAAGTTGAGGTTTTTGACTCAGGGTCTTCTCGGCACATCACT
CCCTATCGTAATTCATTCACCACTTTCGAGTCTATTACGCCTCGCACTCTTCGAGCAGCCAACCAACAACAATTC
AGCGCAGTTGGCAAAGGCGAAGTAAACGTTGACGTACCAAATGGTGACTTTGTATCCCAAATTCGTCTCAAAGAG
GTGTTGTACACACCTAAGGCCAGCTACACTTTGATTTCAATTGGCCGATTGGACGACGAAGGCTTTACGACTACA
TTCCGTGATGGGAAATGTATTATCCGAAACTCGGAGGGTGTTCGTATCGCTGAAATCCCTAGAAATGATAAGGGA
TTATACAAGTTAATCAAAGGCAATGGTGACGAAGTCAATATCGTGACGGAATCACTTACAAGGGATGCTCTTCAC
CGTCGTCTGGGTCATATTTCACCTATCGCCGCTGAGAAACTCGTTAATGACGAACTCATCACTGGTATAAAGCTC
ATTGAAGGGAAACCAGATGTTTCTTGTGATTCATGCGCATATGCAAAGGCTACGAGGCAACCAATCGCTAAAGTT
CGAGAGGGTGAGAGGGCAACTCGAGTAGGAGAGGAGATCCATACAGATGTGTGGGGGCCAGCCAGAGTTGCTACC
AAAAAGGGACGACGTTATTATGTCACTTTTACGGACGACTATTCGAGATGGACTCACATCGAGTTCTTGACGAAC
AAATCCGATGTCTTCGATGCATATAAATGTTTTGAAGCATGGTGCGAAACTCAATTTGATGTTCGTATCAAGGTT
CTGCACTCGGATCGGGGAGGGGAGTATACGTCTGAAGAATTTCAGCGTTATCTCAAATCTCGTGGTACGGAAATA
AAACTTACCGTTCATGACACCCCTCAACATAATGGAGTCGCGGAACGTCGAAATCGTACAATCGCTTGA
Gene >AgabiH97|013320
ATGTCAAGTACAACAGCTATAAACGATGTGCTCCCGCCTACAGTGCCTGCATTGGAGGTTTCCGGATCGAACTGG
GCGATTTTCGAGTTGCGATTTCGGATGGTAATCCAAGGGAAGGGCCTGTGGGGTCATTTTGACGGGACAGTTCCT
CGTCCCACACCACCGCGTGCTACTACTCCAGTGACACGTCCCTCTACTCCAGTTCCACCTACTTCTTCCACTGCG
ACTGCAGCACAAGTAGCTTTACCTTCGACACCAGCTCCTACAACGGCCGATCTTGACGCCTGGGATCGAAACAAA
AACATATCCCTCTCGCTCTTGGCCCAGCGTATTCCCGACTCTACACTTGTTGTCGTTTCAACCCAACCTACAGTT
AGAGCAATGTGGATGAAGATAGTACAAGAATATACGTACAAAAGTGCCTTTTCGCAGGCAAACCTTTGTCAAGAC
TTCATGTCTTCGCGTTGCCCAATCGGTGGAGATGTACGCTTGTTCTTGAATGACTTGCGAGCTAAGAAAGCAGAA
TTGTTAGCCATCGGTGTTCATATTACAGATGATGAATACCGAAGTGCGATTATCCAATCATTACCTCGCTGGTTG
TCAACGTACGCTTCGAATCAACTTTCGGCAGCTCGTCTTCACACCTCCCTTCATAACACAATTGATCCCGATCTC
TTGATTGTCATGATCTGTGACGAATGGGACCGTACCCGTCGCTTCGCTAAGAAGAGTCAGAAGACTGAAGGGAAT
GATGCTCTGGGTGTAGAAACAGAAGACAAGAAAAAGGGAAAAGGAAAGGATAAAGCTAAAGGAAAGGAGAAGAAA
AAGGGACCATGTTGGATTTGTGAAGGAGATCACTGGAAGAGAGATTGCCCAAAGCGGAAGAAAGAGGAGGAAAAC
AAAGAGAAGGAGAAGTCAAAACCCAGTGCTAATGCCGTAGCTGAAGACGATGATGACTCGTTGACGGTGGATATT
GAGGAGGTAGGGAAGGTTTCTGAGATGACGGAACAAGTTGAGGTTTTTGACTCAGGGTCTTCTCGGCACATCACT
CCCTATCGTAATTCATTCACCACTTTCGAGTCTATTACGCCTCGCACTCTTCGAGCAGCCAACCAACAACAATTC
AGCGCAGTTGGCAAAGGCGAAGTAAACGTTGACGTACCAAATGGTGACTTTGTATCCCAAATTCGTCTCAAAGAG
GTGTTGTACACACCTAAGGCCAGCTACACTTTGATTTCAATTGGCCGATTGGACGACGAAGGCTTTACGACTACA
TTCCGTGATGGGAAATGTATTATCCGAAACTCGGAGGGTGTTCGTATCGCTGAAATCCCTAGAAATGATAAGGGA
TTATACAAGTTAATCAAAGGCAATGGTGACGAAGTCAATATCGTGACGGAATCACTTACAAGGGATGCTCTTCAC
CGTCGTCTGGGTCATATTTCACCTATCGCCGCTGAGAAACTCGTTAATGACGAACTCATCACTGGTATAAAGCTC
ATTGAAGGGAAACCAGATGTTTCTTGTGATTCATGCGCATATGCAAAGGCTACGAGGCAACCAATCGCTAAAGTT
CGAGAGGGTGAGAGGGCAACTCGAGTAGGAGAGGAGATCCATACAGATGTGTGGGGGCCAGCCAGAGTTGCTACC
AAAAAGGGACGACGTTATTATGTCACTTTTACGGACGACTATTCGAGATGGACTCACATCGAGTTCTTGACGAAC
AAATCCGATGTCTTCGATGCATATAAATGTTTTGAAGCATGGTGCGAAACTCAATTTGATGTTCGTATCAAGGTT
CTGCACTCGGATCGGGGAGGGGAGTATACGTCTGAAGAATTTCAGCGTTATCTCAAATCTCGTGGTACGGAAATA
AAACTTACCGTTCATGACACCCCTCAACATAATGGAGTCGCGGAACGTCGAAATCGTACAATCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail