Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|013250
Gene name
Locationscaffold_1:3153601..3155547
Strand+
Gene length (bp)1946
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02992 Transposase_21 Transposase family tnp2 5.2E-14 366 481

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|013250
MPYCYCTKCEGTNNYTSQTLRKHITRDWGYVQQSDNQETIEYYHAAIRATQESLELQVEEQTGQEGDSEVAPTPD
LLGSDTLYDSGFQVLPRIDSKASPISIFPGPGASYTSELQPPLHPQSPSPSEASTWADVYDSEDSTGKSEDSAGA
ESLASQDKNQMEVDSSSDSSDSDDLMCSEDVPELLKLREELLGKYKLPEAPPDNQFLLEELDESQRITLKHYIAW
QNSNGTVAAYDAHRKVLQDVLGDQCEVFSLFRARNLAAHLTQLTPSYVDMCPNSCIAFTGQYAQLERCSYMKKGK
QPCNAPRYIPPHKPSAQFTVLPVMATIRAMFANHETANLLRHRDRCLREALSLVAIAKDVPLSDFHPRDVAFALS
TDGAQLTMKKQSNTWVLILILLNLPPEIRYISHNTIIVLATPGPNSPGNIESFIYPLFQEMMQASEGLWMWDAIT
SSNFVLRAWIVMALGDMLGSAKLNGMAGHSAIYGDRFSLIQAAQSSTLSGAKAQYYPLNPPQNDVYNPSRSVYPS
GQIPLRSEHHYWHTISLLHNPSNSKADLVKITKTTGISKMPLCAASQAFIHPSFFPLDPFHLFMENDASFLWDLW
TSTSAKSHTTYANL*
Coding >AgabiH97|013250
ATGCCTTACTGCTATTGCACGAAATGTGAAGGGACGAATAACTACACCAGTCAAACACTCAGAAAGCACATAACA
AGGGATTGGGGGTATGTTCAGCAATCAGATAATCAAGAGACAATTGAATACTATCATGCCGCAATCAGAGCAACC
CAGGAGTCCTTAGAACTACAGGTTGAAGAACAAACTGGGCAAGAAGGAGACTCCGAGGTTGCCCCCACCCCCGAT
CTTCTGGGTTCTGACACCTTGTACGACTCTGGCTTCCAAGTACTGCCCCGGATTGACTCCAAGGCCTCCCCTATC
TCCATTTTTCCGGGCCCCGGCGCCTCATACACCTCTGAGTTACAGCCCCCATTGCATCCTCAAAGCCCATCTCCA
TCGGAAGCCAGTACCTGGGCTGATGTATACGACTCTGAGGATTCAACGGGCAAGAGTGAGGATTCTGCAGGTGCC
GAATCTTTGGCATCGCAGGACAAGAATCAAATGGAAGTAGATTCATCATCCGACAGCTCGGATTCGGATGATCTC
ATGTGTTCGGAAGACGTTCCTGAGCTTCTGAAGCTACGAGAGGAGCTTTTAGGCAAATACAAACTTCCCGAAGCC
CCGCCTGATAATCAGTTCTTGCTTGAAGAGCTGGATGAATCTCAGCGGATTACTCTGAAGCATTATATTGCGTGG
CAAAACTCTAATGGGACGGTCGCAGCTTATGATGCCCATCGAAAAGTTCTTCAGGATGTTTTAGGCGATCAATGC
GAAGTCTTTTCCCTTTTCAGGGCTCGGAATCTTGCAGCCCATTTGACGCAGCTTACTCCCAGCTATGTGGACATG
TGTCCTAACAGCTGTATTGCCTTTACTGGGCAATATGCGCAACTTGAACGGTGTTCCTACATGAAAAAGGGGAAA
CAACCCTGTAATGCTCCCCGCTATATACCTCCACACAAACCATCTGCCCAATTCACTGTTTTACCCGTCATGGCC
ACGATTCGAGCAATGTTTGCTAATCATGAAACTGCCAACTTGCTTCGCCACCGTGATCGTTGCCTGAGAGAAGCT
CTTTCTTTGGTTGCTATAGCCAAAGATGTTCCTCTATCTGATTTCCATCCACGAGATGTTGCGTTTGCTCTTTCA
ACTGATGGTGCTCAGTTGACAATGAAAAAGCAATCCAATACATGGGTTCTTATCCTTATCCTGCTTAACCTTCCT
CCGGAGATACGTTATATATCTCACAATACTATTATTGTCTTGGCGACACCTGGTCCCAACTCTCCTGGCAACATC
GAGTCATTCATATATCCTCTTTTCCAAGAGATGATGCAAGCCAGTGAAGGATTGTGGATGTGGGATGCTATCACC
TCGTCAAATTTTGTTTTACGAGCATGGATTGTCATGGCGCTTGGAGATATGTTGGGTTCAGCAAAACTCAATGGA
ATGGCTGGTCATTCAGCGATTTATGGTGATCGCTTTAGTCTCATTCAAGCTGCACAATCCAGTACTTTATCGGGA
GCAAAAGCGCAGTATTATCCATTAAATCCTCCACAAAATGATGTTTATAATCCAAGCCGGTCAGTGTATCCTAGT
GGTCAAATTCCTCTTCGATCAGAGCACCACTACTGGCATACTATCAGCTTACTTCACAATCCTTCGAACTCAAAA
GCCGACTTGGTTAAAATTACAAAAACTACTGGAATATCCAAAATGCCACTGTGTGCTGCTAGTCAGGCATTTATC
CATCCCAGCTTTTTCCCTCTCGATCCCTTTCATCTGTTCATGGAAAACGATGCTTCATTTCTATGGGATTTATGG
ACTAGTACATCAGCAAAAAGTCACACAACTTATGCAAACTTATGA
Transcript >AgabiH97|013250
ATGCCTTACTGCTATTGCACGAAATGTGAAGGGACGAATAACTACACCAGTCAAACACTCAGAAAGCACATAACA
AGGGATTGGGGGTATGTTCAGCAATCAGATAATCAAGAGACAATTGAATACTATCATGCCGCAATCAGAGCAACC
CAGGAGTCCTTAGAACTACAGGTTGAAGAACAAACTGGGCAAGAAGGAGACTCCGAGGTTGCCCCCACCCCCGAT
CTTCTGGGTTCTGACACCTTGTACGACTCTGGCTTCCAAGTACTGCCCCGGATTGACTCCAAGGCCTCCCCTATC
TCCATTTTTCCGGGCCCCGGCGCCTCATACACCTCTGAGTTACAGCCCCCATTGCATCCTCAAAGCCCATCTCCA
TCGGAAGCCAGTACCTGGGCTGATGTATACGACTCTGAGGATTCAACGGGCAAGAGTGAGGATTCTGCAGGTGCC
GAATCTTTGGCATCGCAGGACAAGAATCAAATGGAAGTAGATTCATCATCCGACAGCTCGGATTCGGATGATCTC
ATGTGTTCGGAAGACGTTCCTGAGCTTCTGAAGCTACGAGAGGAGCTTTTAGGCAAATACAAACTTCCCGAAGCC
CCGCCTGATAATCAGTTCTTGCTTGAAGAGCTGGATGAATCTCAGCGGATTACTCTGAAGCATTATATTGCGTGG
CAAAACTCTAATGGGACGGTCGCAGCTTATGATGCCCATCGAAAAGTTCTTCAGGATGTTTTAGGCGATCAATGC
GAAGTCTTTTCCCTTTTCAGGGCTCGGAATCTTGCAGCCCATTTGACGCAGCTTACTCCCAGCTATGTGGACATG
TGTCCTAACAGCTGTATTGCCTTTACTGGGCAATATGCGCAACTTGAACGGTGTTCCTACATGAAAAAGGGGAAA
CAACCCTGTAATGCTCCCCGCTATATACCTCCACACAAACCATCTGCCCAATTCACTGTTTTACCCGTCATGGCC
ACGATTCGAGCAATGTTTGCTAATCATGAAACTGCCAACTTGCTTCGCCACCGTGATCGTTGCCTGAGAGAAGCT
CTTTCTTTGGTTGCTATAGCCAAAGATGTTCCTCTATCTGATTTCCATCCACGAGATGTTGCGTTTGCTCTTTCA
ACTGATGGTGCTCAGTTGACAATGAAAAAGCAATCCAATACATGGGTTCTTATCCTTATCCTGCTTAACCTTCCT
CCGGAGATACGTTATATATCTCACAATACTATTATTGTCTTGGCGACACCTGGTCCCAACTCTCCTGGCAACATC
GAGTCATTCATATATCCTCTTTTCCAAGAGATGATGCAAGCCAGTGAAGGATTGTGGATGTGGGATGCTATCACC
TCGTCAAATTTTGTTTTACGAGCATGGATTGTCATGGCGCTTGGAGATATGTTGGGTTCAGCAAAACTCAATGGA
ATGGCTGGTCATTCAGCGATTTATGGTGATCGCTTTAGTCTCATTCAAGCTGCACAATCCAGTACTTTATCGGGA
GCAAAAGCGCAGTATTATCCATTAAATCCTCCACAAAATGATGTTTATAATCCAAGCCGGTCAGTGTATCCTAGT
GGTCAAATTCCTCTTCGATCAGAGCACCACTACTGGCATACTATCAGCTTACTTCACAATCCTTCGAACTCAAAA
GCCGACTTGGTTAAAATTACAAAAACTACTGGAATATCCAAAATGCCACTGTGTGCTGCTAGTCAGGCATTTATC
CATCCCAGCTTTTTCCCTCTCGATCCCTTTCATCTGTTCATGGAAAACGATGCTTCATTTCTATGGGATTTATGG
ACTAGTACATCAGCAAAAAGTCACACAACTTATGCAAACTTATGA
Gene >AgabiH97|013250
ATGCCTTACTGCTATTGCACGAAATGTGAAGGGACGAATAACTACACCAGTCAAACACTCAGAAAGCACATAACA
AGGGATTGGGGGTATGTTCAGCAATCAGATAATCAAGAGACAATTGAATACTATCATGCCGCAATCAGAGCAACC
CAGGAGTCCTTAGAACTACAGGTTGAAGAACAAACTGGGCAAGAAGGAGACTCCGAGGTTGCCCCCACCCCCGAT
CTTCTGGGTTCTGACACCTTGTACGACTCTGGCTTCCAAGTACTGCCCCGGATTGACTCCAAGGCCTCCCCTATC
TCCATTTTTCCGGGCCCCGGCGCCTCATACACCTCTGAGTTACAGCCCCCATTGCATCCTCAAAGCCCATCTCCA
TCGGAAGCCAGTACCTGGGCTGATGTATACGACTCTGAGGATTCAACGGGCAAGAGTGAGGATTCTGCAGGTGCC
GAATCTTTGGCATCGCAGGACAAGAATCAAATGGAAGTAGATTCATCATCCGACAGCTCGGATTCGGATGATCTC
ATGTGTTCGGAAGACGTTCCTGAGCTTCTGAAGCTACGAGAGGAGCTTTTAGGTGATTATCTTACTCTTGAAACG
TTATTACGATAATGAATCTATTTTGAAGGCAAATACAAACTTCCCGAAGCCCCGCCTGATAATCAGTTCTTGCTT
GAAGAGCTGGATGAATCTCAGCGGATTACTCTGAAGCATTATATTGCGTGGCAAAACTCTAATGGGACGGTCGCA
GCTTATGATGCCCATCGAAAAGTTCTTCAGGATGTTTTAGGCGATCAATGCGAAGTCTTTTCCCTTTTCAGGGCT
CGGAATCTTGCAGCCCATTTGACGCAGCTTACTCCCAGCTATGTGGACATGTGTCCTAACAGCTGTATTGCCTTT
ACTGGGCAATATGCGCAACTTGAACGGTGTTCCTACATGAAAAAGGGGAAACAACCCTGTAATGCTCCCCGCTAT
ATACCTCCACACAAACCATCTGCCCAATTCACTGTTTTACCCGTCATGGCCACGATTCGAGCAATGTTTGCTAAT
CATGAAACTGCCAACTTGCTTCGCCACCGTGATCGTTGCCTGAGAGAAGCTCTTTCTTTGGTTGCTATAGCCAAA
GATGTTCCTCTATCTGATTTCCGTCATCATCTGTTCACCGTTATCATTACAACAATCTGGACCTGTTTCAAGATC
CACGAGATGTTGCGTTTGCTCTTTCAACTGATGGTGCTCAGTTGACAATGAAAAAGCAATCCAATACATGGGTTC
TTATCCTTATCCTGCTTAACCTTCCTCCGGAGATACGTTATATATCTCACAATACTATTATTGTCTTGGCGACAC
CTGGTCCCAACTCTCCTGGCAACATCGAGTCATTCATATATCCTCTTTTCCAAGAGATGATGCAAGCCAGTGAAG
GATTGTGGATGTGGGATGCTATCACCTCGTCAAATTTTGTTTTACGAGCATGGATTGTCATGGCGCTTGGAGATA
TGTTGGGTTCAGCAAAACTCAATGGAATGGCTGGTCATTCAGCGATTTATGGTGATCGCTTTAGTCTCATTCAAG
CTGCACAATCCAGTACTTTATCGGGAGCAAAAGCGCAGTATTATCCATTAAATCCTCCACAAAATGATGTTTATA
ATCCAAGCCGGTCAGTGTATCCTAGTGGTCAAATTCCTCTTCGATCAGAGCACCACTACTGGCATACTATCAGCT
TACTTCACAATCCTTCGAACTCAAAAGCCGACTTGGTTAAAATTACAAAAACTACTGGAATATCCAAAATGCCAC
TGTGTGCTGCTAGTCAGGCATTTATCCATCCCAGCTTTTTCCCTCTCGATCCCTTTCATCTGTTCATGGAAAACG
ATGCTTCATTTCTATGGGATTTATGGACTAGTACATCAGCAAAAAGTCACACAACTTATGCAAACTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail