Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|012330
Gene name
Locationscaffold_1:2932656..2933420
Strand+
Gene length (bp)764
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 9.0E-09 63 105
PF00646 F-box F-box domain 2.5E-06 64 93

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5696 0.464 0.0329 0.0808 0.2549 0.0093 0.1042 0.0836 0.0978 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 107.07 62.59 151.54
Initials Initials knots 97.65 57.03 138.28
Pileal_Stipeal_center Stage I stipe center 104.29 60.85 147.74
Pileal_Stipeal_shell Stage I stipe shell 107.54 62.71 152.36
DIF_stipe_center Stage II stipe center 109.02 64.28 153.76
DIF_stipe_shell Stage II stipe shell 114.55 67.67 161.44
DIF_stipe_skin Stage II stipe skin 106.62 62.28 150.95
DIF_cap_skin Stage II cap skin 122.90 72.92 172.89
DIF_cap_tissue Stage II cap tissue 121.56 72.05 171.06
DIF_gill_tissue Stage II gill tissue 121.29 71.87 170.70
YFB_stipe_center Young fruiting body stipe center 106.19 62.13 150.24
YFB_stipe_shell Young fruiting body stipe shell 118.73 70.03 167.43
YFB_stipe_skin Young fruiting body stipe skin 110.26 64.47 156.04
YFB_cap_skin Young fruiting body cap skin 130.06 77.17 182.96
YFB_cap_tissue Young fruiting body cap tissue 123.60 73.11 174.10
YFB_gill_tissue Young fruiting body gill tissue 108.46 63.34 153.57
YFB_veil Young fruiting body veil 112.78 65.87 159.69

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.783388 no
Casing YFB_stipe_center 0.988399 no
Casing YFB_stipe_shell 0.826699 no
Casing YFB_stipe_skin 0.958596 no
Casing YFB_cap_skin 0.617596 no
Casing YFB_cap_tissue 0.742952 no
Casing YFB_gill_tissue 0.981167 no
Casing YFB_veil 0.924526 no
Casing Initials 0.855109 no
Casing Pileal_Stipeal_center 0.963094 no
Casing Pileal_Stipeal_shell 0.993471 no
Casing DIF_stipe_center 0.973963 no
Casing DIF_stipe_shell 0.895075 no
Casing DIF_stipe_skin 0.993329 no
Casing DIF_cap_skin 0.757537 no
Casing DIF_cap_tissue 0.777604 no
DIF_gill_tissue YFB_stipe_center 0.762381 no
DIF_gill_tissue YFB_stipe_shell 0.970184 no
DIF_gill_tissue YFB_stipe_skin 0.844050 no
DIF_gill_tissue YFB_cap_skin 0.888030 no
DIF_gill_tissue YFB_cap_tissue 0.972740 no
DIF_gill_tissue YFB_gill_tissue 0.808105 no
DIF_gill_tissue YFB_veil 0.886776 no
YFB_stipe_center YFB_stipe_shell 0.807212 no
YFB_stipe_center YFB_stipe_skin 0.946525 no
YFB_stipe_center YFB_cap_skin 0.594074 no
YFB_stipe_center YFB_cap_tissue 0.721179 no
YFB_stipe_center YFB_gill_tissue 0.969488 no
YFB_stipe_center YFB_veil 0.911464 no
YFB_stipe_shell YFB_stipe_skin 0.882578 no
YFB_stipe_shell YFB_cap_skin 0.846189 no
YFB_stipe_shell YFB_cap_tissue 0.938769 no
YFB_stipe_shell YFB_gill_tissue 0.850816 no
YFB_stipe_shell YFB_veil 0.923899 no
YFB_stipe_skin YFB_cap_skin 0.687973 no
YFB_stipe_skin YFB_cap_tissue 0.803720 no
YFB_stipe_skin YFB_gill_tissue 0.976227 no
YFB_stipe_skin YFB_veil 0.967690 no
YFB_cap_skin YFB_cap_tissue 0.923922 no
YFB_cap_skin YFB_gill_tissue 0.651288 no
YFB_cap_skin YFB_veil 0.742323 no
YFB_cap_tissue YFB_gill_tissue 0.767054 no
YFB_cap_tissue YFB_veil 0.850836 no
YFB_gill_tissue YFB_veil 0.944800 no
Initials DIF_gill_tissue 0.553101 no
Initials YFB_stipe_center 0.866189 no
Initials YFB_stipe_shell 0.608653 no
Initials YFB_stipe_skin 0.790819 no
Initials YFB_cap_skin 0.393265 no
Initials YFB_cap_tissue 0.510756 no
Initials YFB_gill_tissue 0.824881 no
Initials YFB_veil 0.740181 no
Initials Pileal_Stipeal_center 0.900370 no
Initials Pileal_Stipeal_shell 0.842284 no
Initials DIF_stipe_center 0.809851 no
Initials DIF_stipe_shell 0.697910 no
Initials DIF_stipe_skin 0.857734 no
Initials DIF_cap_skin 0.527764 no
Initials DIF_cap_tissue 0.549364 no
Pileal_Stipeal_center DIF_gill_tissue 0.720198 no
Pileal_Stipeal_center YFB_stipe_center 0.975278 no
Pileal_Stipeal_center YFB_stipe_shell 0.767979 no
Pileal_Stipeal_center YFB_stipe_skin 0.917769 no
Pileal_Stipeal_center YFB_cap_skin 0.550636 no
Pileal_Stipeal_center YFB_cap_tissue 0.677433 no
Pileal_Stipeal_center YFB_gill_tissue 0.943812 no
Pileal_Stipeal_center YFB_veil 0.879681 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.957470 no
Pileal_Stipeal_center DIF_stipe_center 0.936068 no
Pileal_Stipeal_center DIF_stipe_shell 0.846629 no
Pileal_Stipeal_center DIF_stipe_skin 0.969387 no
Pileal_Stipeal_center DIF_cap_skin 0.693681 no
Pileal_Stipeal_center DIF_cap_tissue 0.715490 no
Pileal_Stipeal_shell DIF_gill_tissue 0.791266 no
Pileal_Stipeal_shell YFB_stipe_center 0.982398 no
Pileal_Stipeal_shell YFB_stipe_shell 0.834647 no
Pileal_Stipeal_shell YFB_stipe_skin 0.965367 no
Pileal_Stipeal_shell YFB_cap_skin 0.631762 no
Pileal_Stipeal_shell YFB_cap_tissue 0.752734 no
Pileal_Stipeal_shell YFB_gill_tissue 0.987837 no
Pileal_Stipeal_shell YFB_veil 0.932054 no
Pileal_Stipeal_shell DIF_stipe_center 0.980942 no
Pileal_Stipeal_shell DIF_stipe_shell 0.903475 no
Pileal_Stipeal_shell DIF_stipe_skin 0.987929 no
Pileal_Stipeal_shell DIF_cap_skin 0.765260 no
Pileal_Stipeal_shell DIF_cap_tissue 0.785172 no
DIF_stipe_center DIF_gill_tissue 0.816052 no
DIF_stipe_center YFB_stipe_center 0.963168 no
DIF_stipe_center YFB_stipe_shell 0.859544 no
DIF_stipe_center YFB_stipe_skin 0.984198 no
DIF_stipe_center YFB_cap_skin 0.654162 no
DIF_stipe_center YFB_cap_tissue 0.776430 no
DIF_stipe_center YFB_gill_tissue 0.992484 no
DIF_stipe_center YFB_veil 0.952341 no
DIF_stipe_center DIF_stipe_shell 0.924712 no
DIF_stipe_center DIF_stipe_skin 0.969118 no
DIF_stipe_center DIF_cap_skin 0.789564 no
DIF_stipe_center DIF_cap_tissue 0.810856 no
DIF_stipe_shell DIF_gill_tissue 0.913279 no
DIF_stipe_shell YFB_stipe_center 0.880038 no
DIF_stipe_shell YFB_stipe_shell 0.948117 no
DIF_stipe_shell YFB_stipe_skin 0.945798 no
DIF_stipe_shell YFB_cap_skin 0.770222 no
DIF_stipe_shell YFB_cap_tissue 0.877905 no
DIF_stipe_shell YFB_gill_tissue 0.918414 no
DIF_stipe_shell YFB_veil 0.978015 no
DIF_stipe_shell DIF_stipe_skin 0.888589 no
DIF_stipe_shell DIF_cap_skin 0.890203 no
DIF_stipe_shell DIF_cap_tissue 0.907920 no
DIF_stipe_skin DIF_gill_tissue 0.770109 no
DIF_stipe_skin YFB_stipe_center 0.993261 no
DIF_stipe_skin YFB_stipe_shell 0.815664 no
DIF_stipe_skin YFB_stipe_skin 0.953385 no
DIF_stipe_skin YFB_cap_skin 0.604968 no
DIF_stipe_skin YFB_cap_tissue 0.728588 no
DIF_stipe_skin YFB_gill_tissue 0.975035 no
DIF_stipe_skin YFB_veil 0.918987 no
DIF_stipe_skin DIF_cap_skin 0.743415 no
DIF_stipe_skin DIF_cap_tissue 0.763555 no
DIF_cap_skin DIF_gill_tissue 0.980563 no
DIF_cap_skin YFB_stipe_center 0.732335 no
DIF_cap_skin YFB_stipe_shell 0.949718 no
DIF_cap_skin YFB_stipe_skin 0.816391 no
DIF_cap_skin YFB_cap_skin 0.913186 no
DIF_cap_skin YFB_cap_tissue 0.991144 no
DIF_cap_skin YFB_gill_tissue 0.781251 no
DIF_cap_skin YFB_veil 0.863469 no
DIF_cap_skin DIF_cap_tissue 0.984198 no
DIF_cap_tissue DIF_gill_tissue 0.996132 no
DIF_cap_tissue YFB_stipe_center 0.759081 no
DIF_cap_tissue YFB_stipe_shell 0.966507 no
DIF_cap_tissue YFB_stipe_skin 0.843631 no
DIF_cap_tissue YFB_cap_skin 0.894796 no
DIF_cap_tissue YFB_cap_tissue 0.975292 no
DIF_cap_tissue YFB_gill_tissue 0.807785 no
DIF_cap_tissue YFB_veil 0.886043 no

Orthologs

Orthofinder run ID1
Orthogroup3360
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|012330
Agaricus bisporus var bisporus H97 AgabiH97|012330 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|231_11

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|012330
MSLLFTVLRSASQHESDDDDLINVVSPANTRPSSPTLKGAAARPIPKPLLLNKSRSRTDPLRVLPTELSQRIFSR
LRLSDLAKCSLVSKKWNRSQTINYVWFQHYRRDNFHDESLPPGKWSKRESKQNWRLVHLKTLRERSPPSTPFSRY
SSAYNSGYQTPREMKEEQWRLEAETTSKPGKLEMREMYKELGGRKARSKAKLGSSGPIRDRGGWADGDDGWP*
Coding >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGTC
TGGTTTCAGCACTATCGAAGAGACAACTTTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCC
AAACAGAACTGGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTTCCACCCCCTTCTCACGTTAC
TCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAATGGCGTCTCGAGGCCGAGACT
ACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGCGCAAAGCTCGCTCAAAAGCA
AAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATGATGGATGGCCCTAG
Transcript >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGTC
TGGTTTCAGCACTATCGAAGAGACAACTTTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCC
AAACAGAACTGGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTTCCACCCCCTTCTCACGTTAC
TCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAATGGCGTCTCGAGGCCGAGACT
ACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGCGCAAAGCTCGCTCAAAAGCA
AAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATGATGGATGGCCCTAG
Gene >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGGT
CAGTCAACACACGTTTTTCGCATTTCTCCTTTAACCCTTCTCCAGTCTGGTTTCAGCACTATCGAAGAGACAACT
TTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCCAAACAGAACTGGGTCTGTCTCTTTTCCC
CAATGACCACATCTCTTTCTGACTGCATGCAGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTT
CCACCCCCTTCTCACGTTACTCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAAT
GGCGTCTCGAGGCCGAGACTACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGC
GCAAAGCTCGCTCAAAAGCAAAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATG
ATGGATGGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail