Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|012330
Gene name
Locationscaffold_1:2932656..2933420
Strand+
Gene length (bp)764
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 9.0E-09 63 105
PF00646 F-box F-box domain 2.5E-06 64 93

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5696 0.464 0.0329 0.0808 0.2549 0.0093 0.1042 0.0836 0.0978 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup3360
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|012330
Agaricus bisporus var bisporus H97 AgabiH97|012330 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|231_11

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|012330
MSLLFTVLRSASQHESDDDDLINVVSPANTRPSSPTLKGAAARPIPKPLLLNKSRSRTDPLRVLPTELSQRIFSR
LRLSDLAKCSLVSKKWNRSQTINYVWFQHYRRDNFHDESLPPGKWSKRESKQNWRLVHLKTLRERSPPSTPFSRY
SSAYNSGYQTPREMKEEQWRLEAETTSKPGKLEMREMYKELGGRKARSKAKLGSSGPIRDRGGWADGDDGWP*
Coding >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGTC
TGGTTTCAGCACTATCGAAGAGACAACTTTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCC
AAACAGAACTGGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTTCCACCCCCTTCTCACGTTAC
TCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAATGGCGTCTCGAGGCCGAGACT
ACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGCGCAAAGCTCGCTCAAAAGCA
AAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATGATGGATGGCCCTAG
Transcript >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGTC
TGGTTTCAGCACTATCGAAGAGACAACTTTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCC
AAACAGAACTGGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTTCCACCCCCTTCTCACGTTAC
TCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAATGGCGTCTCGAGGCCGAGACT
ACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGCGCAAAGCTCGCTCAAAAGCA
AAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATGATGGATGGCCCTAG
Gene >AgabiH97|012330
ATGAGTCTCCTCTTCACCGTCCTCCGCTCTGCCTCCCAGCACGAGAGCGACGACGACGACCTCATCAACGTCGTC
TCCCCCGCCAACACCCGCCCTTCCTCTCCAACCCTCAAGGGCGCTGCCGCCCGCCCCATCCCCAAACCTCTTCTC
CTCAACAAATCCCGCAGCCGCACAGATCCTCTCCGTGTGCTCCCCACAGAACTCTCCCAGCGCATCTTCTCTCGC
CTGCGCTTAAGCGATCTTGCAAAATGCTCTCTTGTATCGAAAAAATGGAATCGGAGTCAGACAATCAACTATGGT
CAGTCAACACACGTTTTTCGCATTTCTCCTTTAACCCTTCTCCAGTCTGGTTTCAGCACTATCGAAGAGACAACT
TTCACGATGAAAGCCTGCCTCCGGGCAAGTGGTCCAAGCGCGAATCCAAACAGAACTGGGTCTGTCTCTTTTCCC
CAATGACCACATCTCTTTCTGACTGCATGCAGCGTCTGGTCCATCTCAAGACACTACGGGAACGTTCCCCTCCTT
CCACCCCCTTCTCACGTTACTCATCCGCTTACAACTCCGGTTATCAAACACCTCGCGAGATGAAAGAAGAACAAT
GGCGTCTCGAGGCCGAGACTACTTCCAAACCTGGTAAACTCGAGATGCGTGAAATGTACAAAGAGCTGGGCGGGC
GCAAAGCTCGCTCAAAAGCAAAATTGGGCAGTTCAGGCCCCATTCGGGATAGAGGAGGATGGGCCGATGGTGATG
ATGGATGGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail