Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011890
Gene name
Locationscaffold_1:2817823..2822787
Strand+
Gene length (bp)4964
Transcript length (bp)4359
Coding sequence length (bp)4359
Protein length (aa) 1453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.1E-74 576 872
PF00271 Helicase_C Helicase conserved C-terminal domain 1.3E-18 896 1009
PF00439 Bromodomain Bromodomain 1.1E-18 1302 1375
PF07529 HSA HSA domain 3.1E-19 402 472
PF08880 QLQ QLQ 7.3E-15 117 151
PF14619 SnAC Snf2-ATP coupling, chromatin remodelling complex 3.9E-12 1105 1174
PF04851 ResIII Type III restriction enzyme, res subunit 1.7E-07 573 732

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 280 1377 0.0E+00
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 91 1380 0.0E+00
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 263 1225 0.0E+00
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 283 1180 0.0E+00
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 550 1387 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 280 1377 0.0E+00
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 91 1380 0.0E+00
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 263 1225 0.0E+00
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 283 1180 0.0E+00
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 550 1387 0.0E+00
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 550 1387 0.0E+00
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 550 1387 0.0E+00
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 550 1387 0.0E+00
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 550 1387 0.0E+00
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 550 1387 0.0E+00
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 535 1178 0.0E+00
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 436 1114 0.0E+00
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 274 1202 0.0E+00
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 426 1192 0.0E+00
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 565 1093 2.0E-141
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 561 1091 6.0E-139
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 565 1093 1.0E-138
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 554 1091 4.0E-138
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 554 1091 1.0E-137
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 565 1093 2.0E-137
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 560 1094 3.0E-137
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 341 1105 7.0E-137
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 560 1094 1.0E-136
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 561 1047 3.0E-136
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 552 1094 3.0E-135
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 563 1049 7.0E-132
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 563 1048 1.0E-124
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 560 1093 2.0E-123
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 559 1058 1.0E-122
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 526 1087 1.0E-120
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 561 1045 3.0E-119
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 560 1047 8.0E-119
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 567 1093 8.0E-119
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 557 1092 3.0E-118
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 561 1045 5.0E-117
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 560 1072 6.0E-116
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 560 1072 8.0E-116
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 560 1072 1.0E-115
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 560 1094 1.0E-114
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 563 1051 9.0E-114
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 557 1092 5.0E-113
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 560 1093 2.0E-112
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 561 1045 6.0E-112
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 556 1094 6.0E-112
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 568 1094 1.0E-111
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 552 1049 2.0E-111
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 568 1171 9.0E-111
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 557 1047 2.0E-110
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 561 1045 6.0E-110
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 568 1118 1.0E-109
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 557 1047 3.0E-109
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 561 1045 3.0E-109
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 560 1201 5.0E-109
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 560 1201 9.0E-109
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 573 1045 5.0E-108
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 570 1091 3.0E-107
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 573 1049 1.0E-106
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 557 1120 2.0E-105
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 573 1091 2.0E-105
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 573 1091 2.0E-105
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 573 1091 3.0E-105
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 573 1120 4.0E-105
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 573 1120 5.0E-105
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 573 1120 7.0E-105
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 557 1120 7.0E-105
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 573 1120 5.0E-104
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 573 1120 1.0E-103
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 573 1120 1.0E-103
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 570 1091 2.0E-103
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 561 1083 1.0E-101
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 564 1087 2.0E-94
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 569 1088 3.0E-93
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 561 1073 3.0E-92
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 564 1040 2.0E-89
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 564 1043 4.0E-88
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 563 1040 1.0E-87
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 556 1096 3.0E-87
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 573 1066 6.0E-87
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 564 1047 9.0E-87
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 557 1053 1.0E-86
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 564 1047 1.0E-86
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 557 1053 3.0E-86
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 561 1085 2.0E-84
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 562 1043 8.0E-83
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 567 1044 9.0E-81
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 572 1076 1.0E-80
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 573 1045 3.0E-80
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 569 1141 2.0E-77
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 573 1044 4.0E-76
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 567 874 8.0E-76
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 564 879 7.0E-75
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 569 1077 1.0E-74
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 564 879 2.0E-74
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 557 931 3.0E-74
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 539 887 4.0E-74
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 564 886 5.0E-74
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 538 874 6.0E-74
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 573 1040 8.0E-74
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 564 879 2.0E-73
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 564 879 2.0E-73
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 564 879 3.0E-73
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 573 1045 5.0E-73
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 563 874 6.0E-73
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 557 886 2.0E-72
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 563 1049 2.0E-72
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 564 879 2.0E-72
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 563 1049 4.0E-72
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 535 886 5.0E-72
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 564 879 8.0E-72
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 557 886 9.0E-72
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 564 877 1.0E-71
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 568 874 1.0E-71
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 567 874 1.0E-71
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 564 881 2.0E-71
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 562 874 2.0E-71
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 568 874 3.0E-71
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 573 1045 3.0E-71
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 568 875 4.0E-71
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 567 882 5.0E-71
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 564 882 1.0E-70
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 564 882 1.0E-70
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 564 882 1.0E-70
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 425 907 1.0E-70
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 573 1053 1.0E-70
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 564 886 2.0E-70
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 568 874 3.0E-70
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 568 874 3.0E-70
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 425 901 3.0E-70
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 573 1058 5.0E-70
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 568 875 8.0E-70
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 523 873 1.0E-69
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 568 877 1.0E-69
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 562 874 3.0E-69
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 562 874 3.0E-69
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 568 877 3.0E-69
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 567 874 3.0E-69
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 563 874 3.0E-69
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 564 877 1.0E-68
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 564 874 2.0E-68
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 564 885 3.0E-68
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 568 874 3.0E-68
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 573 1061 4.0E-68
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 567 873 8.0E-68
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 573 1036 1.0E-67
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 569 1048 2.0E-67
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 562 882 4.0E-67
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 564 886 2.0E-66
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 564 874 3.0E-66
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 564 905 4.0E-66
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 573 1036 6.0E-66
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 569 1062 7.0E-66
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 589 1048 1.0E-65
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 568 873 1.0E-64
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 545 1157 1.0E-64
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 553 1044 8.0E-63
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 590 1044 5.0E-62
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 537 1148 7.0E-62
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 548 1058 3.0E-61
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 548 1058 1.0E-60
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 568 1071 2.0E-60
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 537 1044 2.0E-60
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 568 1058 9.0E-60
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 568 1058 1.0E-59
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 568 1058 2.0E-59
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 571 1064 3.0E-59
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 568 1136 4.0E-59
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 572 1044 5.0E-59
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 573 1052 9.0E-59
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 568 1136 9.0E-59
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 595 1046 2.0E-58
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 571 1031 2.0E-58
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 568 1044 5.0E-58
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 568 1058 8.0E-58
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 568 1058 1.0E-57
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 595 1117 1.0E-57
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 568 1044 2.0E-57
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 595 1117 2.0E-57
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 595 1117 2.0E-57
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 595 1117 2.0E-57
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 595 1117 7.0E-57
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 573 1055 2.0E-56
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 572 1031 2.0E-54
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 593 1125 8.0E-48
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 884 1049 9.0E-46
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 565 1044 2.0E-44
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 556 899 7.0E-44
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 885 1117 9.0E-44
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 873 1095 8.0E-43
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 873 1098 8.0E-43
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 894 1049 1.0E-42
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 873 1049 2.0E-42
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 894 1049 4.0E-42
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 869 1117 4.0E-42
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 556 908 4.0E-42
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 885 1095 6.0E-42
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 873 1049 8.0E-42
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 885 1049 8.0E-42
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 894 1098 1.0E-41
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 573 1044 1.0E-41
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 889 1047 4.0E-41
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 889 1095 6.0E-41
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 884 1119 7.0E-41
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 894 1053 8.0E-41
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 884 1101 1.0E-40
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 869 1051 2.0E-40
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 869 1051 2.0E-40
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 565 1045 2.0E-40
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 885 1052 3.0E-40
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 573 1044 4.0E-40
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 888 1044 8.0E-40
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 889 1088 1.0E-39
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 889 1048 1.0E-39
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 888 1082 3.0E-39
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 888 1049 7.0E-39
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 773 1098 8.0E-39
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 889 1044 9.0E-39
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 889 1044 9.0E-39
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 889 1099 1.0E-38
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 889 1099 1.0E-38
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 889 1099 1.0E-38
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 888 1087 1.0E-38
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 888 1087 1.0E-38
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 889 1047 1.0E-38
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 888 1049 1.0E-38
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 889 1047 2.0E-38
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 889 1099 2.0E-38
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 888 1049 2.0E-38
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 889 1044 2.0E-38
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 888 1048 2.0E-38
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 889 1099 3.0E-38
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 889 1099 3.0E-38
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 889 1076 3.0E-38
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 888 1055 2.0E-37
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 888 1048 2.0E-37
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 881 1055 3.0E-37
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 889 1047 6.0E-37
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 888 1052 4.0E-36
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 864 1048 7.0E-36
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 894 1055 6.0E-35
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 697 1067 2.0E-34
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 267 515 3.0E-34
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 569 832 9.0E-34
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 250 509 3.0E-33
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 250 509 4.0E-33
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 258 512 8.0E-33
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 258 512 1.0E-32
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 885 1052 1.0E-32
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 258 512 2.0E-32
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 576 1046 2.0E-32
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 258 512 3.0E-32
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 576 1044 3.0E-31
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 569 1084 2.0E-30
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 595 1080 5.0E-30
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 587 1030 1.0E-29
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 595 1030 5.0E-28
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 595 1061 5.0E-28
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 572 1039 9.0E-28
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 571 1084 3.0E-27
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 595 1098 3.0E-27
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 572 1043 3.0E-27
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 573 1030 3.0E-27
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 595 1043 2.0E-26
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 573 880 2.0E-26
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 573 888 5.0E-26
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 595 1046 7.0E-26
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 573 888 2.0E-25
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 573 888 3.0E-25
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 573 888 3.0E-25
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 886 1044 4.0E-24
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 886 1061 5.0E-24
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 886 1061 6.0E-24
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 886 1044 6.0E-24
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 573 1027 2.0E-23
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 595 1039 2.0E-22
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 890 1054 2.0E-22
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 534 842 7.0E-22
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 894 1077 1.0E-21
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 572 875 1.0E-21
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 590 1099 5.0E-21
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 573 1021 6.0E-21
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 557 931 8.0E-21
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 595 1083 1.0E-20
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 573 1021 1.0E-20
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 594 900 1.0E-20
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 563 1073 2.0E-20
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 569 1021 2.0E-20
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 559 874 2.0E-20
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 573 1021 2.0E-20
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 894 1029 4.0E-20
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 894 1029 4.0E-20
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 909 1073 4.0E-20
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 593 878 1.0E-19
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 892 1031 1.0E-19
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 913 1077 2.0E-19
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 913 1077 2.0E-19
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 892 1054 2.0E-19
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 594 891 3.0E-19
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 913 1038 4.0E-19
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 592 872 4.0E-19
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 913 1060 4.0E-19
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 594 878 5.0E-19
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 913 1052 5.0E-19
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 594 875 1.0E-18
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 573 829 1.0E-18
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 894 1049 2.0E-18
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 594 882 5.0E-18
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 892 1029 6.0E-18
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 913 1048 7.0E-18
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 913 1029 7.0E-18
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 626 884 9.0E-18
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 572 878 1.0E-17
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 894 1029 1.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 626 883 1.0E-17
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 626 884 1.0E-17
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 594 869 2.0E-17
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 909 1029 5.0E-17
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 909 1029 7.0E-17
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 892 1026 7.0E-17
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 873 1029 1.0E-16
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 595 1046 1.0E-16
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 892 1029 1.0E-16
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 589 1070 3.0E-16
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 592 872 3.0E-16
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 854 1032 4.0E-16
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 594 927 4.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 889 1031 4.0E-16
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 595 1036 5.0E-16
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 885 1027 5.0E-16
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 913 1062 7.0E-16
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 892 1031 7.0E-16
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 562 803 8.0E-16
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 1304 1376 9.0E-16
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1290 1380 1.0E-15
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 913 1027 1.0E-15
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 594 911 2.0E-15
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 594 873 3.0E-15
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 913 1031 3.0E-15
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 1275 1388 4.0E-15
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 564 832 4.0E-15
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 913 1049 4.0E-15
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 894 1039 5.0E-15
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 592 872 5.0E-15
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 915 1027 6.0E-15
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 573 872 9.0E-15
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 592 877 1.0E-14
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 915 1029 1.0E-14
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 861 1039 2.0E-14
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 1297 1375 5.0E-14
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 1283 1370 8.0E-14
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1267 1380 2.0E-13
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1267 1380 2.0E-13
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1282 1380 3.0E-13
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1282 1380 5.0E-13
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1282 1380 6.0E-13
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1238 1392 1.0E-12
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 626 892 2.0E-12
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 878 1039 3.0E-12
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1238 1392 3.0E-12
sp|O74964|RSC1_SCHPO Chromatin structure-remodeling complex subunit rsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc1 PE=1 SV=1 1298 1390 3.0E-12
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1238 1392 1.0E-11
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1257 1383 1.0E-11
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 1256 1387 3.0E-11
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1282 1383 3.0E-11
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1257 1383 3.0E-11
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 694 1039 6.0E-11
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1286 1382 2.0E-10
sp|Q9M658|MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana GN=MOM1 PE=1 SV=1 855 1034 2.0E-10
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1288 1382 3.0E-10
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1286 1382 4.0E-10
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 626 893 6.0E-10
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 626 893 6.0E-10
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 594 833 6.0E-10
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 689 903 1.0E-09
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 1316 1380 7.0E-09
sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 1308 1387 1.0E-08
sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 1308 1380 2.0E-08
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 1314 1381 6.0E-08
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 1314 1381 6.0E-08
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 685 874 9.0E-08
sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 1308 1380 9.0E-08
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 1314 1387 9.0E-08
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 894 1029 1.0E-07
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 1314 1387 2.0E-07
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 894 1029 2.0E-07
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 1314 1387 2.0E-07
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 913 1026 3.0E-07
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 1308 1380 3.0E-07
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 1308 1380 4.0E-07
sp|P53236|RSC1_YEAST Chromatin structure-remodeling complex subunit RSC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC1 PE=1 SV=1 1290 1370 4.0E-07
sp|P53236|RSC1_YEAST Chromatin structure-remodeling complex subunit RSC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC1 PE=1 SV=1 1298 1387 1.0E-06
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 1314 1381 1.0E-06
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 1308 1380 1.0E-06
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 1316 1417 1.0E-06
sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens GN=CECR2 PE=1 SV=2 1308 1390 2.0E-06
sp|Q06488|RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC2 PE=1 SV=1 1282 1384 2.0E-06
sp|Q55C84|Y0170_DICDI Bromodomain-containing protein DDB_G0270170 OS=Dictyostelium discoideum GN=DDB_G0270170 PE=3 SV=1 1261 1394 2.0E-06
sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans GN=nurf-1 PE=1 SV=2 1308 1380 3.0E-06
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 1308 1381 4.0E-06
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 1314 1420 4.0E-06
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 86 155 5.0E-06
sp|D4A7T3|BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus GN=Brdt PE=1 SV=1 1314 1387 5.0E-06
sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 1308 1438 5.0E-06
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 1314 1387 6.0E-06
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 61 155 7.0E-06
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 1312 1380 8.0E-06
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 1308 1381 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0042393 histone binding Yes
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0016787 hydrolase activity Yes
GO:0005634 nucleus Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0032553 ribonucleotide binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0010468 regulation of gene expression No
GO:1901265 nucleoside phosphate binding No
GO:0019222 regulation of metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0140097 catalytic activity, acting on DNA No
GO:0031323 regulation of cellular metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0043226 organelle No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:2001141 regulation of RNA biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011890
MSAQMLGNGTQAPLQQHPQQRQQSMPDVQQLMQRVSFLRKNPTEQKNPHEAENILKYLAAIGQMQGRNQSQHQAL
LHQSQQPTMTNGHGPHLNGTSTSTSGAPPPTQPPAANQTPISFTPDQIATLRAQIQAFKLLSRGMPLPESMQQAI
RTQNTAISDLEKVAQPSSIPNKIVDAAVKSAKGEASLPATPPVTTGTEDIKAEEMDVAPINPADLPKGPFLEDKV
NSGIYPYNAFRHPFTHLKRTSDNDPPLLATRLQRLLIPTIMPAGLDAHQILNERDRFIEARIQQRIRELETMPST
MGDGAFDVDVEVKDDKTEDKENNSNPLTSLIHPPATAHGKLRALIELKSLRVLDKQRAMRAMVAERLNHGSMLPL
NRLDFRRTRKPTIRDARATENSERRQRAERERRAKHKHVEQLTIICNHGREVVASNRNAQERVARIGRAVLQFHV
YTEKEEQKRIERLAKERLKALKADDEEAYMKLIDTAKDTRITHLLRQTDSFLDSLAQAVVQQQNEGGIVYENYDT
EPTSEATFGAQVFDEEATSDKKVDYYAVAHRISEKIARQPNILVGGTLKEYQLKGLQWMVSLYNNKLNGILADEM
GLGKTIQTISLVTFLIEVKRQRGPYLVIVPLSTMTNWSGEFAKWAPSVRMIAYKGNPTQRRALQAELRMNQFQVL
LTTYEYIIKDRPHLSKIKWVHMIIDEGHRMKNTQSKLVQTLTTYYHSRYRLILTGTPLQNNLPELWALLNFVLPR
IFNSVKSFDEWFNTPFANSGTGEKIELNEEEALLIIRRLHKVLRPFLLRRLKKDVESELPDKVEKVIKIRMSALQ
SQLYKQMKKYKMIADGKETKGKAAGMKGLGLSNELMQLRKICQHPFLFESVEDKISPSGYVDDKLIRTSGKIELL
NRVLPKFFSTGHRVLIFFQMTKVMDIMEDFLKMQGWKYLRLDGGTKTEERASFVQLFNATDSEYKVFILSTRAGG
LGLNLQTADTVIIFDSDWNPHADLQAQDRAHRIGQTKAVLILRFITEKSVEEAMYQRARFKLDIDDKVIQAGKFD
NKSTQEEQEEFLRSILEADQEEENEEAGDMNDDELNELIARTEDEGRVFRQLDIERERKAMEAWRAAGNRGKPLP
SLMQLEELPECYQTDEPFEVKEAEEIIEGRGHRRKNVVSYNDGLSDDAWAMALEDGEDLQELSERTKEKKDRRLN
NKLLKDAEASARGTPVSDDSRGRKVKKGKNKVEDYNAGAKRKRGQKSMSVTPSIAEDEDEDHDPKRRRKANNDIP
PAIRERMKKGFAECHKAVLACEDETGRKRCELFRELPDKRDYPDYYQLITQPIALSHLRKRANSNFYKTLQAYRD
DWKLMFNNARTYNQEGSWVYVDAEEMEKIFIATFNRVFVGSGLPGAPVAATGITQTGSTSGSYDSALTPMEDDDR
PPPIRGRSAGRKQVLSDEEYLTPSDDE*
Coding >AgabiH97|011890
ATGTCCGCCCAAATGCTGGGCAATGGCACCCAAGCGCCTCTCCAGCAGCATCCTCAACAGCGACAACAGTCCATG
CCCGATGTCCAGCAGCTCATGCAGCGCGTCTCCTTCCTCCGTAAAAACCCCACAGAACAGAAGAATCCCCATGAA
GCAGAGAACATTTTGAAATACCTTGCAGCTATTGGCCAAATGCAAGGCCGCAATCAGAGCCAGCATCAGGCACTC
CTCCATCAGTCCCAACAGCCTACCATGACCAATGGACATGGTCCTCACCTTAATGGCACCTCTACTTCAACCTCT
GGCGCACCTCCCCCAACCCAACCTCCGGCAGCCAATCAGACACCCATATCCTTTACGCCAGATCAAATAGCTACT
CTCCGTGCACAGATACAGGCCTTCAAGCTTCTCAGTCGTGGAATGCCCCTTCCCGAGTCCATGCAGCAAGCCATT
CGTACTCAAAATACTGCTATCTCAGACCTTGAGAAAGTCGCTCAACCTTCCTCCATCCCCAACAAAATTGTCGAT
GCAGCAGTCAAGTCAGCCAAAGGCGAAGCCAGTCTGCCTGCAACCCCCCCAGTAACCACCGGCACAGAGGATATC
AAGGCTGAGGAAATGGATGTGGCACCCATTAATCCCGCCGACCTCCCGAAAGGCCCTTTTTTAGAGGACAAAGTC
AATTCTGGAATATACCCCTACAACGCATTTCGCCATCCCTTCACCCACTTAAAACGCACGTCCGACAATGACCCC
CCTCTGTTGGCGACTCGCCTTCAACGTCTCCTAATCCCTACCATTATGCCGGCCGGTCTCGATGCTCATCAGATT
CTGAATGAACGTGACCGTTTTATCGAAGCTCGCATTCAGCAACGAATACGGGAACTCGAAACCATGCCTTCGACC
ATGGGAGATGGTGCTTTCGATGTCGATGTCGAGGTGAAGGACGACAAAACGGAAGACAAGGAAAACAACTCTAAT
CCTTTAACTTCCCTTATCCATCCACCTGCCACTGCACATGGGAAGCTTCGAGCCCTTATTGAACTTAAGTCATTG
CGTGTCCTTGACAAGCAACGTGCGATGCGAGCAATGGTAGCGGAGCGTCTCAACCACGGTTCTATGCTTCCGCTC
AACCGGCTCGACTTCCGTCGTACTCGTAAACCGACTATTCGTGACGCTCGCGCCACGGAAAATTCGGAGCGTCGG
CAGCGTGCGGAGCGAGAACGTCGTGCTAAGCACAAACATGTCGAACAACTCACCATCATTTGCAACCATGGCCGC
GAAGTTGTTGCCTCCAATCGCAATGCCCAGGAACGTGTCGCGCGCATTGGTCGTGCGGTGTTGCAATTCCATGTC
TACACTGAGAAGGAGGAGCAGAAACGTATCGAGCGTCTTGCCAAGGAACGTTTGAAGGCTCTTAAAGCTGATGAT
GAAGAGGCGTATATGAAACTCATCGATACTGCCAAAGATACCCGTATCACTCATCTACTTCGCCAGACTGACTCT
TTCTTGGATTCCCTCGCGCAGGCCGTTGTTCAACAACAGAATGAAGGAGGGATAGTGTATGAGAATTATGACACT
GAACCGACATCGGAAGCAACGTTCGGCGCTCAAGTCTTCGATGAGGAAGCCACTAGCGACAAGAAAGTCGATTAT
TATGCGGTTGCGCATCGTATTTCAGAGAAGATTGCCAGACAACCCAACATTCTTGTTGGTGGTACGTTGAAGGAA
TATCAGCTCAAAGGTTTACAGTGGATGGTCAGCTTGTACAACAACAAGCTTAATGGTATTTTGGCGGATGAAATG
GGTCTGGGTAAAACTATTCAGACCATCTCCCTGGTAACCTTCTTGATCGAAGTAAAACGGCAACGAGGACCTTAT
CTAGTCATTGTGCCTTTGTCGACCATGACCAACTGGTCTGGAGAATTCGCGAAATGGGCACCTTCAGTCAGGATG
ATTGCTTATAAAGGCAATCCTACCCAGCGGAGAGCTCTGCAAGCGGAGTTGCGCATGAATCAGTTCCAGGTCTTG
TTGACTACCTATGAGTATATCATCAAGGACAGACCTCATCTCAGTAAGATCAAATGGGTTCACATGATCATCGAT
GAGGGTCATCGGATGAAGAACACCCAATCCAAGCTCGTTCAGACCTTAACAACTTACTACCACTCTCGCTACCGT
CTTATTCTCACCGGAACGCCACTGCAAAACAACCTCCCGGAACTTTGGGCTTTACTCAATTTCGTGCTTCCTAGG
ATATTTAACTCGGTCAAATCGTTTGATGAATGGTTCAATACTCCGTTCGCTAATTCCGGTACTGGAGAGAAGATT
GAGTTGAACGAAGAAGAGGCGCTCCTCATTATTCGTCGCCTGCACAAGGTGCTGCGTCCGTTCCTGCTCAGGCGT
CTCAAGAAAGATGTCGAGTCTGAGTTGCCAGACAAAGTTGAGAAGGTTATCAAGATTAGAATGAGTGCGCTTCAA
AGTCAGTTGTACAAGCAGATGAAGAAGTATAAGATGATTGCCGACGGGAAGGAAACTAAGGGGAAAGCTGCTGGT
ATGAAAGGTTTGGGTTTGAGTAATGAGCTCATGCAATTACGGAAAATCTGCCAACACCCGTTTCTCTTTGAGAGC
GTGGAAGACAAGATCAGCCCTAGTGGATATGTGGACGATAAACTGATCCGTACATCTGGAAAGATCGAACTACTC
AACCGTGTTCTTCCCAAGTTCTTTTCCACTGGTCACAGAGTTCTGATTTTCTTCCAAATGACAAAGGTCATGGAT
ATCATGGAAGATTTTTTGAAGATGCAAGGCTGGAAGTACCTTCGTTTGGATGGTGGAACCAAGACAGAAGAGCGT
GCTTCTTTCGTACAACTTTTCAACGCCACAGATTCAGAGTACAAGGTCTTCATTCTGTCGACTAGGGCTGGTGGC
CTGGGTCTCAATTTGCAGACAGCTGACACTGTCATCATCTTTGATTCTGACTGGAACCCCCACGCCGATCTCCAG
GCACAAGATCGTGCTCACCGTATCGGTCAAACCAAAGCGGTGCTCATTCTTCGTTTCATCACGGAGAAGAGTGTA
GAGGAAGCAATGTATCAGCGAGCAAGGTTCAAACTCGATATAGATGACAAAGTTATCCAGGCCGGCAAGTTTGAC
AACAAGTCGACCCAGGAGGAACAGGAGGAATTTTTGCGGTCTATTTTGGAAGCTGACCAAGAGGAAGAGAACGAA
GAAGCTGGCGATATGAATGATGATGAGCTTAACGAGCTTATTGCCCGCACCGAGGATGAGGGAAGAGTATTCCGT
CAGCTTGACATAGAACGGGAACGTAAGGCTATGGAGGCTTGGCGTGCCGCTGGGAATAGGGGTAAACCGTTGCCA
TCGCTAATGCAACTTGAGGAGTTGCCAGAGTGTTATCAGACAGACGAGCCCTTCGAAGTCAAAGAGGCAGAAGAG
ATCATCGAGGGACGAGGTCATCGGAGGAAGAATGTGGTCAGTTATAATGATGGACTAAGTGATGATGCGTGGGCT
ATGGCGCTGGAAGATGGCGAGGACTTGCAGGAGCTTTCTGAACGGACCAAGGAAAAGAAGGACCGGAGGCTCAAC
AACAAACTCCTAAAGGATGCTGAGGCTTCTGCTCGTGGCACACCCGTATCGGATGATAGTCGCGGTCGCAAGGTG
AAGAAGGGTAAGAACAAAGTGGAAGATTACAACGCCGGGGCGAAGCGAAAACGCGGGCAGAAATCAATGTCTGTA
ACACCCTCCATCGCTGAGGATGAAGATGAAGATCACGATCCGAAACGACGTAGGAAGGCCAATAATGACATTCCT
CCTGCCATACGCGAACGGATGAAGAAAGGCTTTGCAGAGTGTCATAAAGCAGTGCTTGCTTGCGAAGATGAGACT
GGGCGGAAACGTTGCGAGCTTTTCCGGGAGTTACCAGACAAAAGGGACTACCCCGATTATTATCAGCTTATTACA
CAGCCTATCGCACTCTCCCATCTGCGCAAACGTGCCAACAGCAATTTCTATAAAACCTTGCAAGCATACAGGGAC
GACTGGAAGCTCATGTTCAATAATGCGCGAACTTATAATCAGGAAGGATCTTGGGTGTACGTCGATGCAGAGGAG
ATGGAGAAAATATTTATAGCGACGTTCAACCGCGTTTTCGTGGGCTCTGGACTTCCTGGTGCACCAGTAGCAGCA
ACTGGTATTACCCAAACTGGGTCGACATCAGGATCGTATGATTCGGCTTTGACCCCCATGGAAGATGACGATCGA
CCGCCGCCTATACGCGGACGGAGTGCAGGGCGGAAACAGGTATTGAGCGATGAAGAGTATCTAACTCCTAGCGAT
GACGAATGA
Transcript >AgabiH97|011890
ATGTCCGCCCAAATGCTGGGCAATGGCACCCAAGCGCCTCTCCAGCAGCATCCTCAACAGCGACAACAGTCCATG
CCCGATGTCCAGCAGCTCATGCAGCGCGTCTCCTTCCTCCGTAAAAACCCCACAGAACAGAAGAATCCCCATGAA
GCAGAGAACATTTTGAAATACCTTGCAGCTATTGGCCAAATGCAAGGCCGCAATCAGAGCCAGCATCAGGCACTC
CTCCATCAGTCCCAACAGCCTACCATGACCAATGGACATGGTCCTCACCTTAATGGCACCTCTACTTCAACCTCT
GGCGCACCTCCCCCAACCCAACCTCCGGCAGCCAATCAGACACCCATATCCTTTACGCCAGATCAAATAGCTACT
CTCCGTGCACAGATACAGGCCTTCAAGCTTCTCAGTCGTGGAATGCCCCTTCCCGAGTCCATGCAGCAAGCCATT
CGTACTCAAAATACTGCTATCTCAGACCTTGAGAAAGTCGCTCAACCTTCCTCCATCCCCAACAAAATTGTCGAT
GCAGCAGTCAAGTCAGCCAAAGGCGAAGCCAGTCTGCCTGCAACCCCCCCAGTAACCACCGGCACAGAGGATATC
AAGGCTGAGGAAATGGATGTGGCACCCATTAATCCCGCCGACCTCCCGAAAGGCCCTTTTTTAGAGGACAAAGTC
AATTCTGGAATATACCCCTACAACGCATTTCGCCATCCCTTCACCCACTTAAAACGCACGTCCGACAATGACCCC
CCTCTGTTGGCGACTCGCCTTCAACGTCTCCTAATCCCTACCATTATGCCGGCCGGTCTCGATGCTCATCAGATT
CTGAATGAACGTGACCGTTTTATCGAAGCTCGCATTCAGCAACGAATACGGGAACTCGAAACCATGCCTTCGACC
ATGGGAGATGGTGCTTTCGATGTCGATGTCGAGGTGAAGGACGACAAAACGGAAGACAAGGAAAACAACTCTAAT
CCTTTAACTTCCCTTATCCATCCACCTGCCACTGCACATGGGAAGCTTCGAGCCCTTATTGAACTTAAGTCATTG
CGTGTCCTTGACAAGCAACGTGCGATGCGAGCAATGGTAGCGGAGCGTCTCAACCACGGTTCTATGCTTCCGCTC
AACCGGCTCGACTTCCGTCGTACTCGTAAACCGACTATTCGTGACGCTCGCGCCACGGAAAATTCGGAGCGTCGG
CAGCGTGCGGAGCGAGAACGTCGTGCTAAGCACAAACATGTCGAACAACTCACCATCATTTGCAACCATGGCCGC
GAAGTTGTTGCCTCCAATCGCAATGCCCAGGAACGTGTCGCGCGCATTGGTCGTGCGGTGTTGCAATTCCATGTC
TACACTGAGAAGGAGGAGCAGAAACGTATCGAGCGTCTTGCCAAGGAACGTTTGAAGGCTCTTAAAGCTGATGAT
GAAGAGGCGTATATGAAACTCATCGATACTGCCAAAGATACCCGTATCACTCATCTACTTCGCCAGACTGACTCT
TTCTTGGATTCCCTCGCGCAGGCCGTTGTTCAACAACAGAATGAAGGAGGGATAGTGTATGAGAATTATGACACT
GAACCGACATCGGAAGCAACGTTCGGCGCTCAAGTCTTCGATGAGGAAGCCACTAGCGACAAGAAAGTCGATTAT
TATGCGGTTGCGCATCGTATTTCAGAGAAGATTGCCAGACAACCCAACATTCTTGTTGGTGGTACGTTGAAGGAA
TATCAGCTCAAAGGTTTACAGTGGATGGTCAGCTTGTACAACAACAAGCTTAATGGTATTTTGGCGGATGAAATG
GGTCTGGGTAAAACTATTCAGACCATCTCCCTGGTAACCTTCTTGATCGAAGTAAAACGGCAACGAGGACCTTAT
CTAGTCATTGTGCCTTTGTCGACCATGACCAACTGGTCTGGAGAATTCGCGAAATGGGCACCTTCAGTCAGGATG
ATTGCTTATAAAGGCAATCCTACCCAGCGGAGAGCTCTGCAAGCGGAGTTGCGCATGAATCAGTTCCAGGTCTTG
TTGACTACCTATGAGTATATCATCAAGGACAGACCTCATCTCAGTAAGATCAAATGGGTTCACATGATCATCGAT
GAGGGTCATCGGATGAAGAACACCCAATCCAAGCTCGTTCAGACCTTAACAACTTACTACCACTCTCGCTACCGT
CTTATTCTCACCGGAACGCCACTGCAAAACAACCTCCCGGAACTTTGGGCTTTACTCAATTTCGTGCTTCCTAGG
ATATTTAACTCGGTCAAATCGTTTGATGAATGGTTCAATACTCCGTTCGCTAATTCCGGTACTGGAGAGAAGATT
GAGTTGAACGAAGAAGAGGCGCTCCTCATTATTCGTCGCCTGCACAAGGTGCTGCGTCCGTTCCTGCTCAGGCGT
CTCAAGAAAGATGTCGAGTCTGAGTTGCCAGACAAAGTTGAGAAGGTTATCAAGATTAGAATGAGTGCGCTTCAA
AGTCAGTTGTACAAGCAGATGAAGAAGTATAAGATGATTGCCGACGGGAAGGAAACTAAGGGGAAAGCTGCTGGT
ATGAAAGGTTTGGGTTTGAGTAATGAGCTCATGCAATTACGGAAAATCTGCCAACACCCGTTTCTCTTTGAGAGC
GTGGAAGACAAGATCAGCCCTAGTGGATATGTGGACGATAAACTGATCCGTACATCTGGAAAGATCGAACTACTC
AACCGTGTTCTTCCCAAGTTCTTTTCCACTGGTCACAGAGTTCTGATTTTCTTCCAAATGACAAAGGTCATGGAT
ATCATGGAAGATTTTTTGAAGATGCAAGGCTGGAAGTACCTTCGTTTGGATGGTGGAACCAAGACAGAAGAGCGT
GCTTCTTTCGTACAACTTTTCAACGCCACAGATTCAGAGTACAAGGTCTTCATTCTGTCGACTAGGGCTGGTGGC
CTGGGTCTCAATTTGCAGACAGCTGACACTGTCATCATCTTTGATTCTGACTGGAACCCCCACGCCGATCTCCAG
GCACAAGATCGTGCTCACCGTATCGGTCAAACCAAAGCGGTGCTCATTCTTCGTTTCATCACGGAGAAGAGTGTA
GAGGAAGCAATGTATCAGCGAGCAAGGTTCAAACTCGATATAGATGACAAAGTTATCCAGGCCGGCAAGTTTGAC
AACAAGTCGACCCAGGAGGAACAGGAGGAATTTTTGCGGTCTATTTTGGAAGCTGACCAAGAGGAAGAGAACGAA
GAAGCTGGCGATATGAATGATGATGAGCTTAACGAGCTTATTGCCCGCACCGAGGATGAGGGAAGAGTATTCCGT
CAGCTTGACATAGAACGGGAACGTAAGGCTATGGAGGCTTGGCGTGCCGCTGGGAATAGGGGTAAACCGTTGCCA
TCGCTAATGCAACTTGAGGAGTTGCCAGAGTGTTATCAGACAGACGAGCCCTTCGAAGTCAAAGAGGCAGAAGAG
ATCATCGAGGGACGAGGTCATCGGAGGAAGAATGTGGTCAGTTATAATGATGGACTAAGTGATGATGCGTGGGCT
ATGGCGCTGGAAGATGGCGAGGACTTGCAGGAGCTTTCTGAACGGACCAAGGAAAAGAAGGACCGGAGGCTCAAC
AACAAACTCCTAAAGGATGCTGAGGCTTCTGCTCGTGGCACACCCGTATCGGATGATAGTCGCGGTCGCAAGGTG
AAGAAGGGTAAGAACAAAGTGGAAGATTACAACGCCGGGGCGAAGCGAAAACGCGGGCAGAAATCAATGTCTGTA
ACACCCTCCATCGCTGAGGATGAAGATGAAGATCACGATCCGAAACGACGTAGGAAGGCCAATAATGACATTCCT
CCTGCCATACGCGAACGGATGAAGAAAGGCTTTGCAGAGTGTCATAAAGCAGTGCTTGCTTGCGAAGATGAGACT
GGGCGGAAACGTTGCGAGCTTTTCCGGGAGTTACCAGACAAAAGGGACTACCCCGATTATTATCAGCTTATTACA
CAGCCTATCGCACTCTCCCATCTGCGCAAACGTGCCAACAGCAATTTCTATAAAACCTTGCAAGCATACAGGGAC
GACTGGAAGCTCATGTTCAATAATGCGCGAACTTATAATCAGGAAGGATCTTGGGTGTACGTCGATGCAGAGGAG
ATGGAGAAAATATTTATAGCGACGTTCAACCGCGTTTTCGTGGGCTCTGGACTTCCTGGTGCACCAGTAGCAGCA
ACTGGTATTACCCAAACTGGGTCGACATCAGGATCGTATGATTCGGCTTTGACCCCCATGGAAGATGACGATCGA
CCGCCGCCTATACGCGGACGGAGTGCAGGGCGGAAACAGGTATTGAGCGATGAAGAGTATCTAACTCCTAGCGAT
GACGAATGA
Gene >AgabiH97|011890
ATGTCCGCCCAAATGCTGGGCAATGGCACCCAAGCGCCTCTCCAGCAGCATCCTCAACAGCGACAACAGTCCATG
CCCGATGTCCAGCAGCTCATGCAGCGCGTCTCCTTCCTCCGTAAAAACCCCACAGAACAGAAGAATCCCCATGAA
GCAGAGAACATTTTGAAATACCTTGCAGCTATTGGCCAAAGTTCGTATTCCCCTTCATGCTCGTACCGATCCTCA
TACTCAAACACTTACAGTGCAAGGCCGCAATCAGAGCCAGCATCAGGCACTCCTCCATCAGTCCCAACAGCCTAC
CATGACCAATGGACATGGTCCTCACCTTAATGGCACCTCTACTTCAACCTCTGGCGCACCTCCCCCAACCCAACC
TCCGGCAGCCAATCAGACACCCATATCCTTTACGCCAGATCAAATAGCTACTCTCCGTGCACAGATACAGGCCTT
CAAGCTTCTCAGTCGTGGAATGCCCCTTCCCGAGTCCATGCAGCAAGCCATTCGTACTCAAAATACTGCTATCTC
AGACCTTGAGAAAGTCGCTCAACCTTCCTCCATCCCCAACAAAATTGTCGATGCAGCAGTCAAGTCAGCCAAAGG
CGAAGCCAGTCTGCCTGCAACCCCCCCAGTAACCACCGGCACAGAGGATATCAAGGCTGAGGAAATGGATGTGGC
ACCCATTAATCCCGCCGACCTCCCGAAAGGCCCTTTTTTAGAGGACAAAGTCAATTCTGGAATATACCCCTACAA
CGCATTTCGCCATCCCTTCACCCACTTAAAACGCACGTCCGACAATGACCCCCCTCTGTTGGCGACTCGCCTTCA
ACGTCTCCTAATCCCTACCATTATGCCGGCCGGTCTCGATGCTCATCAGATTCTGAATGAACGTGACCGTTTTAT
CGAAGCTCGCATTCAGCAACGAATACGGGAACTCGAAACCATGCCTTCGACCATGGGAGATGGTGCTTTCGATGT
CGATGTCGAGGTGAAGGACGACAAAACGGAAGACAAGGAAAACAACTCTAATCCTTTAACTTCCCTTATCCATCC
ACCTGCCACTGCACATGGGAAGCTTCGAGCCCTTATTGAACTTAAGTCATTGCGTGTCCTTGACAAGCAACGTGC
GATGCGAGCAATGGTAGCGGAGCGTCTCAACCACGGTTCTATGCTTCCGCTCAACCGGCTCGACTTCCGTCGTAC
TCGTAAACCGACTATTCGTGACGCTCGCGCCACGGAAAATTCGGAGCGTCGGCAGCGTGCGGAGCGAGAACGTCG
TGCTAAGCACAAACATGTCGAACAACTCACCATCATTTGCAACCATGGCCGCGAAGTTGTTGCCTCCAATCGCAA
TGCCCAGGAACGTGTCGCGCGCATTGGTCGTGCGGTGTTGCAATTCCATGTCTACACTGAGAAGGAGGAGCAGAA
ACGTATCGAGCGTCTTGCCAAGGAACGTTTGAAGGCTCTTAAAGCTGATGATGAAGAGGCGTATATGAAACTCAT
CGATACTGCCAAAGATACCCGTATCACTCATCTACTTCGCCAGACTGACTCTTTCTTGGATTCCCTCGCGCAGGC
CGTTGTTCAACAACAGAATGAAGGAGGGATAGTGTATGAGAATTATGACACTGAACCGACATCGGAAGCAACGTT
CGGCGCTCAAGTCTTCGATGAGGAAGCCACTAGCGACAAGAAAGTCGATTATTATGCGGTTGCGCATCGTATTTC
AGAGAAGATTGCCAGACAACCCAACATTCTTGTTGGTGGTACGTTGAAGGAATATCAGCTCAAAGGTTTACAGTG
GATGGTCAGCTTGTACAACAACAAGCTTAATGGTATTTTGGCGGATGAAATGGTGAGTTCTTATATGTGTTGATT
CTACTACAAAGTCTCATATAACTTTGATTAGGGTCTGGGTAAAACTATTCAGACCATCTCCCTGGTAACCTTCTT
GATCGAAGTAAAACGGCAACGAGGACCTTATCTAGTCATTGTGCCTTTGTCGACCATGACCAACTGGTCTGGAGA
ATTCGCGAAATGGGCACCTTCAGTCAGGATGATTGCTTATAAAGGCAATCCTACCCAGCGGAGAGCTCTGCAAGC
GGAGTTGCGCATGAATCAGTTCCAGGTCTTGTTGACTACCTATGAGTATATCATCAAGGACAGACCTCATCTCAG
TAAGATCAAATGGGTTCACATGATCATCGGTCGGTTTTTTATCGAGTTGTTCGCTATTTTCGTTGCTCATATATG
CCCGTAGATGAGGGTCATCGGATGAAGAACACCCAATCCAAGCTCGTTCAGACCTTAACAACTTACTACCACTCT
CGCTACCGTCTTATTCTCACCGGAACGCCACTGCAAAACAACCTCCCGGAACTTTGGGCTTTACTCAATTTCGTG
CTTCCTAGGATATTTAACTCGGTCAAATCGTTTGATGAATGGTTCAATACTCCGTTCGCTAATTCCGGTACTGGA
GAGAAGATTGAGTTGAACGAAGAAGAGGCGCTCCTCATTATTCGTCGCCTGCACAAGGTGCTGCGTCCGTTCCTG
CTCAGGCGTCTCAAGAAAGATGTCGAGTCTGAGTTGCCAGACAAAGTTGAGAAGGTTATCAAGATTAGAATGAGT
GCGCTTCAAAGTCAGTTGTACAAGCAGATGAAGAAGTATAAGATGATTGCCGACGGGAAGGAAACTAAGGGGTAA
GTGGCCTAACTTCTGTCCGCGGATAGAGTAGTAATCTGTTGTCTTCTTATAGGAAAGCTGCTGGTATGAAAGGTT
TGGGTTTGAGTAATGAGCTCATGCAATTACGGAAAATCTGCCAACACCCGTTTCTCTTTGAGAGCGTGGAAGACA
AGATCAGCCCTAGTGGATATGTGGACGATAAACTGATCCGTACATCTGGAAAGATCGAACTACTCAACCGTGTTC
TTCCCAAGTTCTTTTCCACTGGTCACAGAGTATGACCTCTACTTGTTCGTTTAGTTTACATGATGCTGATGTTTC
ATTCAGGTTCTGATTTTCTTCCAAATGACAAAGGTCATGGATATCATGGAAGATTTTTTGAAGATGCAAGGCTGG
AAGTACCTTCGTTTGGATGGTGGAACCAAGACAGAAGAGCGTGCTTCTTTCGTACAACTTTTCAACGCCACAGAT
TCAGAGTACAAGGTCTTCATTCTGTCGACTAGGGCTGGTGGCCTGGGTCTCAATTTGCAGACAGCTGACACTGTC
ATCATGTGAGTCGATTTCAAGTCAAGTGTATGATGTATACTTATTGAATTGATGATTTCTACAGCTTTGATTCTG
ACTGGTAAATAGATATTGTTGGCGTCAGATGGATTGCCATTGATATATTATTACTTATAGGAACCCCCACGCCGA
TCTCCAGGCACAAGATCGTGCTCACCGTATCGGTCAAACCAAAGCGGTGCTCATTCTTCGTTTCATCACGGAGAA
GAGTGTAGAGGAAGCAATGTATCAGCGAGCAAGGTTCAAACTCGATATAGATGACAAAGTTATCCAGGCCGGCAA
GTTTGACAACAAGTCGACCCAGGAGGAACAGGAGGAATTTTTGGTGCGTCTGACCGCCTGTTTTCTGTTTCAAAC
TCGTTAATCATATGAATGTTATTAGCGGTCTATTTTGGAAGCTGACCAAGAGGAAGAGAACGAAGAAGCTGGCGA
TATGAATGATGATGAGCTTAACGAGCTTATTGCCCGCACCGAGGATGAGGGAAGAGTATTCCGTCAGCTTGACAT
AGAACGGGAACGTAAGGCTATGGAGGCTTGGCGTGCCGCTGGGAATAGGGGTAAACCGTTGCCATCGCTAATGCA
ACTTGAGGAGTTGCCAGAGTGTTATCAGACAGACGAGCCCTTCGAAGTCAAAGAGGCAGAAGAGATCATCGAGGG
ACGAGGTCATCGGAGGAAGAATGTGGTCAGTTATAATGATGGACTAAGTGATGATGCGTGGGCTATGGTGAGTGT
CAGTTATCATTAAGTCTGGTGCTTGTTTAATGATGGAAACAGGCGCTGGAAGATGGCGAGGACTTGCAGGAGCTT
TCTGAACGGACCAAGGAAAAGAAGGACCGGAGGCTCAACAACAAACTCCTAAAGGATGCTGAGGCTTCTGCTCGT
GGCACACCCGTATCGGATGATAGTCGCGGTCGCAAGGTGAAGAAGGGTAAGAACAAAGTGGAAGATTACAACGCC
GGGGCGAAGCGAAAACGCGGGCAGAAATCAATGTCTGTAACACCCTCCATCGCTGAGGATGAAGATGAAGATCAC
GATCCGGTTCGAGGTTTTCTCTCCTGTTAGCTGGTTTTTGACTAATCCATTTCATATATATAGAAACGACGTAGG
AAGGCCAATAATGACATTCCTCCTGCCATACGCGAACGGATGAAGAAAGGCTTTGCAGAGTGTCATAAAGCAGTG
CTTGCTTGCGAAGATGAGACTGGGCGGAAACGTTGCGAGCTTTTCCGGGAGTTACCAGACAAAAGGGTACGTCGG
CTTCTCAGCTGCTATGCAAACTGCTACTGAGCGTTTTTTGTTTCTGATAGGACTACCCCGATTATTATCAGCTTA
TTACACAGCCTATCGCACTCTCCCATCTGCGCAAACGTGCCAACAGCAATTTCTATAAAACCTTGCAAGCATACA
GGGACGACTGGAAGCTCATGTTCAATAATGCGCGAACTTATAATCAGGAAGGATCTTGGGTGTACGTCGATGCAG
AGGAGATGGAGAAAATATTTATAGCGACGTTCAACCGCGTTTTCGTGGGCTCTGGACTTCCTGGTGCACCAGTAG
CAGCAACTGGTATTACCCAAACTGGGTCGACATCAGGATCGTATGATTCGGCTTTGACCCCCATGGAAGATGACG
ATCGACCGCCGCCTATACGCGGACGGAGTGCAGGGCGGAAACAGGTATTGAGCGATGAAGAGTATCTAACTCCTA
GCGATGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail