Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011880
Gene name
Locationscaffold_1:2814455..2817745
Strand-
Gene length (bp)3290
Transcript length (bp)2664
Coding sequence length (bp)2664
Protein length (aa) 888

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02735 Ku Ku70/Ku80 beta-barrel domain 8.8E-29 368 521
PF08785 Ku_PK_bind Ku C terminal domain like 4.0E-28 768 886
PF00092 VWA von Willebrand factor type A domain 9.2E-09 74 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H6C5|KU80_CHAGB ATP-dependent DNA helicase II subunit 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU80 PE=3 SV=1 74 643 2.0E-68
sp|Q4WI96|KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ku80 PE=3 SV=1 43 677 1.0E-59
sp|Q7RX73|KU80_NEUCR ATP-dependent DNA helicase II subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-52 PE=3 SV=2 74 675 5.0E-59
sp|Q2MHH2|KU80_ASPOR ATP-dependent DNA helicase II subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku80 PE=3 SV=1 43 641 1.0E-55
sp|Q2MHH1|KU80_ASPSO ATP-dependent DNA helicase II subunit 2 OS=Aspergillus sojae GN=ku80 PE=3 SV=1 43 668 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H6C5|KU80_CHAGB ATP-dependent DNA helicase II subunit 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU80 PE=3 SV=1 74 643 2.0E-68
sp|Q4WI96|KU80_ASPFU ATP-dependent DNA helicase II subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ku80 PE=3 SV=1 43 677 1.0E-59
sp|Q7RX73|KU80_NEUCR ATP-dependent DNA helicase II subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-52 PE=3 SV=2 74 675 5.0E-59
sp|Q2MHH2|KU80_ASPOR ATP-dependent DNA helicase II subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku80 PE=3 SV=1 43 641 1.0E-55
sp|Q2MHH1|KU80_ASPSO ATP-dependent DNA helicase II subunit 2 OS=Aspergillus sojae GN=ku80 PE=3 SV=1 43 668 2.0E-55
sp|Q6C7B9|KU80_YARLI ATP-dependent DNA helicase II subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU80 PE=3 SV=1 33 641 2.0E-54
sp|Q1E6K9|KU80_COCIM ATP-dependent DNA helicase II subunit 2 OS=Coccidioides immitis (strain RS) GN=KU80 PE=3 SV=1 43 641 2.0E-53
sp|Q5B4H8|KU80_EMENI ATP-dependent DNA helicase II subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ku80 PE=3 SV=1 43 644 7.0E-53
sp|Q0U8L4|KU80_PHANO ATP-dependent DNA helicase II subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KU80 PE=3 SV=1 85 642 7.0E-39
sp|Q9HGM8|KU80_SCHPO ATP-dependent DNA helicase II subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pku80 PE=1 SV=1 43 615 9.0E-32
sp|P27641|XRCC5_MOUSE X-ray repair cross-complementing protein 5 OS=Mus musculus GN=Xrcc5 PE=1 SV=4 385 637 4.0E-26
sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens GN=XRCC5 PE=1 SV=3 385 637 7.0E-26
sp|Q54LY5|XRCC5_DICDI X-ray repair cross-complementing protein 5 OS=Dictyostelium discoideum GN=ku80 PE=3 SV=1 385 629 2.0E-24
sp|Q9FQ09|KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana GN=KU80 PE=1 SV=1 384 636 3.0E-18
sp|Q75IP6|KU80_ORYSJ ATP-dependent DNA helicase 2 subunit KU80 OS=Oryza sativa subsp. japonica GN=KU80 PE=1 SV=1 389 661 1.0E-13
sp|Q54LY5|XRCC5_DICDI X-ray repair cross-complementing protein 5 OS=Dictyostelium discoideum GN=ku80 PE=3 SV=1 76 214 1.0E-10
sp|Q04437|KU80_YEAST ATP-dependent DNA helicase II subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKU80 PE=1 SV=1 386 549 2.0E-08
sp|Q9FQ09|KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80 OS=Arabidopsis thaliana GN=KU80 PE=1 SV=1 88 187 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006303 double-strand break repair via nonhomologous end joining Yes
GO:0003677 DNA binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0006259 DNA metabolic process No
GO:0006302 double-strand break repair No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0050896 response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006281 DNA repair No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011880
MSHSIPKRDTLLRPRDPISLVASVPVIRTQTTMAAERAGYTVTMFVVDTTPPMGTLKTIEFPGPEGETLEKTVTH
LEYVLQFAKLKIQEMIFNGRKTDQCGVVTFGSQVTSNIINERNGGYENVEEVFSIAQPTANLLSKLDSLSTSNVK
GDAMDGLIVAIQTQAEYLGKKKSWTRKIVLLTNGECPFEPEHWEAAVQKMDDFGVSLTVVGVDFDDQEVRSMEPK
TISKMESEKFYHKLTSSMRSGVVGNCTFALQEISKPDIKNVRSTLMGNILRLGDVDTMAEEAIEIIVKASKCTSI
SRAKAWKKFALREDDSGEAMVIDGDDSKVAFAPLRLQTEYYVDRSTDDEQDADGDVKMEDNVNPLDENQGEREAT
DEEKENNLEKVEREELVRGFKYGSTYVPCPDGQFLRLPTKKGIDICGFFPVSKFPRELSMGEIQYIWAEPTDPQQ
QVALSSMVQAMREKECVAIARWVSRDDMDPKMGVLYPEAFERVECFLWAQMPFADDIRKYGFASLDKLISKNGEE
IKSHPYIPTESQQNAMDDFVDALDLMNAGEKDEEGNRTPWFNPAESYNPALHRTKQAMFHCAVVTDIASNPLPPP
HPELLKYFDPPKKLLKRAKPAIVQAQEAFKVKEIPKRVVKRGAAANNKGHEYAADDDEMLLLNHKRPKSIDSPMM
GVIKLEPISPSKDKGKAKAMDSGSETEDEEEETGFVTVQHPEEGRRLDGKKPPLATPEPTPQRGVPLPTPARSVS
PQIDLGRAPGRIIGTTFPLKDFKKNLEQGDVVSKAVEDLREVIVEVVMRPFASKRHEEMIDCLRALRDTCLKEDE
IDAWNAFLPRLKEDCLRKNGNPEFWMQVKDLGRDISLISNKEARKYGGAASVSEKRAEEFIA*
Coding >AgabiH97|011880
ATGTCACACTCCATTCCAAAACGTGACACCTTGCTGCGTCCACGTGATCCAATATCCCTCGTCGCGTCTGTCCCA
GTCATTCGCACTCAGACCACCATGGCAGCAGAACGAGCGGGTTACACAGTTACTATGTTTGTCGTCGATACGACA
CCACCCATGGGCACCCTCAAGACCATCGAGTTCCCAGGGCCCGAGGGGGAGACTCTTGAAAAGACCGTCACACAT
CTCGAATATGTCCTCCAGTTTGCCAAGCTCAAAATACAAGAAATGATCTTTAATGGCCGTAAAACCGACCAATGT
GGTGTTGTCACCTTCGGCTCCCAAGTGACAAGTAACATTATCAATGAGAGGAATGGTGGCTACGAGAATGTCGAA
GAGGTATTCTCAATCGCCCAGCCTACCGCCAACCTTCTATCTAAGCTCGATTCATTGAGCACGTCCAATGTAAAA
GGGGATGCCATGGATGGCTTGATTGTAGCCATTCAAACTCAAGCAGAATACCTTGGAAAAAAGAAAAGTTGGACA
CGCAAGATTGTCCTCCTCACAAACGGTGAATGCCCGTTTGAACCTGAACATTGGGAGGCGGCGGTCCAGAAGATG
GACGATTTTGGCGTGTCGTTGACTGTTGTAGGCGTTGATTTTGACGACCAAGAAGTTCGGTCTATGGAACCTAAA
ACTATTTCAAAAATGGAGAGCGAAAAGTTTTACCACAAACTCACCAGTTCCATGAGATCTGGGGTTGTCGGTAAC
TGCACTTTCGCTCTCCAAGAAATTTCCAAACCGGATATCAAAAACGTCCGCTCGACTCTTATGGGTAATATTCTG
CGTCTTGGAGACGTCGATACCATGGCGGAAGAGGCAATCGAAATTATTGTCAAAGCAAGTAAATGCACCTCCATC
TCGCGGGCAAAAGCCTGGAAAAAGTTCGCCTTACGCGAGGATGATTCCGGCGAAGCCATGGTCATCGATGGTGAT
GATTCTAAAGTCGCGTTCGCCCCTCTGAGACTGCAGACCGAGTATTATGTTGACCGGAGTACCGACGATGAGCAA
GACGCAGACGGCGATGTCAAAATGGAGGACAACGTAAATCCGCTTGATGAAAATCAAGGGGAGCGTGAGGCAACG
GACGAAGAGAAGGAAAATAACCTCGAGAAAGTAGAAAGGGAGGAGCTCGTTCGCGGATTCAAGTACGGATCCACG
TATGTCCCTTGTCCAGACGGCCAGTTCCTCCGCCTTCCAACAAAGAAAGGCATCGATATCTGTGGGTTTTTCCCT
GTTAGCAAGTTTCCTCGTGAACTATCTATGGGAGAAATCCAATATATCTGGGCGGAACCTACTGACCCCCAGCAA
CAAGTTGCCCTTTCGTCAATGGTACAAGCCATGCGCGAAAAGGAGTGTGTAGCCATTGCCCGCTGGGTGTCGAGA
GACGATATGGACCCAAAGATGGGAGTGCTATACCCGGAAGCCTTCGAAAGAGTAGAATGCTTTCTATGGGCACAA
ATGCCTTTCGCAGATGACATTCGCAAATACGGCTTTGCTTCTTTGGATAAGCTAATCTCCAAGAACGGCGAAGAA
ATCAAAAGTCACCCTTACATACCTACTGAATCACAGCAAAATGCGATGGACGACTTCGTTGACGCCTTGGATTTG
ATGAACGCGGGCGAAAAAGATGAAGAAGGGAACCGTACACCGTGGTTCAATCCCGCAGAGTCATACAACCCTGCA
CTTCATCGCACGAAGCAAGCCATGTTCCATTGTGCCGTTGTCACTGACATCGCAAGCAATCCACTCCCACCTCCA
CATCCCGAGCTTCTCAAATATTTCGACCCACCCAAAAAGCTCCTCAAACGTGCCAAACCCGCTATCGTGCAAGCA
CAAGAAGCATTCAAAGTCAAAGAAATACCTAAACGAGTTGTGAAACGAGGCGCTGCAGCGAATAATAAAGGACAT
GAGTACGCGGCTGACGACGACGAAATGTTACTACTCAATCACAAACGCCCGAAATCAATCGATTCGCCGATGATG
GGTGTGATCAAACTAGAGCCTATCTCGCCTTCCAAGGATAAGGGGAAAGCCAAAGCTATGGACTCGGGCAGTGAA
ACAGAAGATGAGGAAGAGGAGACTGGGTTCGTAACAGTGCAACATCCGGAGGAAGGGCGTCGACTCGACGGAAAG
AAGCCACCACTAGCCACGCCGGAGCCAACTCCTCAGCGTGGCGTCCCTCTTCCTACGCCAGCGCGCTCGGTATCT
CCACAGATTGATCTAGGAAGAGCACCTGGGAGAATCATCGGCACCACATTCCCATTGAAAGATTTCAAGAAAAAT
CTCGAACAAGGAGATGTGGTCAGCAAAGCTGTGGAGGACCTACGTGAAGTGATAGTGGAAGTGGTGATGAGACCA
TTTGCGTCCAAGAGGCATGAAGAAATGATTGATTGTCTAAGGGCCCTGAGAGATACATGCCTTAAGGAGGACGAA
ATTGATGCATGGAACGCATTTTTACCCCGTCTTAAAGAGGACTGTCTTCGTAAGAACGGTAATCCTGAATTCTGG
ATGCAAGTCAAGGACTTGGGGCGAGATATCAGTCTCATCAGTAATAAAGAAGCCAGAAAGTACGGTGGAGCTGCC
TCGGTCTCAGAGAAACGTGCAGAAGAGTTTATCGCTTGA
Transcript >AgabiH97|011880
ATGTCACACTCCATTCCAAAACGTGACACCTTGCTGCGTCCACGTGATCCAATATCCCTCGTCGCGTCTGTCCCA
GTCATTCGCACTCAGACCACCATGGCAGCAGAACGAGCGGGTTACACAGTTACTATGTTTGTCGTCGATACGACA
CCACCCATGGGCACCCTCAAGACCATCGAGTTCCCAGGGCCCGAGGGGGAGACTCTTGAAAAGACCGTCACACAT
CTCGAATATGTCCTCCAGTTTGCCAAGCTCAAAATACAAGAAATGATCTTTAATGGCCGTAAAACCGACCAATGT
GGTGTTGTCACCTTCGGCTCCCAAGTGACAAGTAACATTATCAATGAGAGGAATGGTGGCTACGAGAATGTCGAA
GAGGTATTCTCAATCGCCCAGCCTACCGCCAACCTTCTATCTAAGCTCGATTCATTGAGCACGTCCAATGTAAAA
GGGGATGCCATGGATGGCTTGATTGTAGCCATTCAAACTCAAGCAGAATACCTTGGAAAAAAGAAAAGTTGGACA
CGCAAGATTGTCCTCCTCACAAACGGTGAATGCCCGTTTGAACCTGAACATTGGGAGGCGGCGGTCCAGAAGATG
GACGATTTTGGCGTGTCGTTGACTGTTGTAGGCGTTGATTTTGACGACCAAGAAGTTCGGTCTATGGAACCTAAA
ACTATTTCAAAAATGGAGAGCGAAAAGTTTTACCACAAACTCACCAGTTCCATGAGATCTGGGGTTGTCGGTAAC
TGCACTTTCGCTCTCCAAGAAATTTCCAAACCGGATATCAAAAACGTCCGCTCGACTCTTATGGGTAATATTCTG
CGTCTTGGAGACGTCGATACCATGGCGGAAGAGGCAATCGAAATTATTGTCAAAGCAAGTAAATGCACCTCCATC
TCGCGGGCAAAAGCCTGGAAAAAGTTCGCCTTACGCGAGGATGATTCCGGCGAAGCCATGGTCATCGATGGTGAT
GATTCTAAAGTCGCGTTCGCCCCTCTGAGACTGCAGACCGAGTATTATGTTGACCGGAGTACCGACGATGAGCAA
GACGCAGACGGCGATGTCAAAATGGAGGACAACGTAAATCCGCTTGATGAAAATCAAGGGGAGCGTGAGGCAACG
GACGAAGAGAAGGAAAATAACCTCGAGAAAGTAGAAAGGGAGGAGCTCGTTCGCGGATTCAAGTACGGATCCACG
TATGTCCCTTGTCCAGACGGCCAGTTCCTCCGCCTTCCAACAAAGAAAGGCATCGATATCTGTGGGTTTTTCCCT
GTTAGCAAGTTTCCTCGTGAACTATCTATGGGAGAAATCCAATATATCTGGGCGGAACCTACTGACCCCCAGCAA
CAAGTTGCCCTTTCGTCAATGGTACAAGCCATGCGCGAAAAGGAGTGTGTAGCCATTGCCCGCTGGGTGTCGAGA
GACGATATGGACCCAAAGATGGGAGTGCTATACCCGGAAGCCTTCGAAAGAGTAGAATGCTTTCTATGGGCACAA
ATGCCTTTCGCAGATGACATTCGCAAATACGGCTTTGCTTCTTTGGATAAGCTAATCTCCAAGAACGGCGAAGAA
ATCAAAAGTCACCCTTACATACCTACTGAATCACAGCAAAATGCGATGGACGACTTCGTTGACGCCTTGGATTTG
ATGAACGCGGGCGAAAAAGATGAAGAAGGGAACCGTACACCGTGGTTCAATCCCGCAGAGTCATACAACCCTGCA
CTTCATCGCACGAAGCAAGCCATGTTCCATTGTGCCGTTGTCACTGACATCGCAAGCAATCCACTCCCACCTCCA
CATCCCGAGCTTCTCAAATATTTCGACCCACCCAAAAAGCTCCTCAAACGTGCCAAACCCGCTATCGTGCAAGCA
CAAGAAGCATTCAAAGTCAAAGAAATACCTAAACGAGTTGTGAAACGAGGCGCTGCAGCGAATAATAAAGGACAT
GAGTACGCGGCTGACGACGACGAAATGTTACTACTCAATCACAAACGCCCGAAATCAATCGATTCGCCGATGATG
GGTGTGATCAAACTAGAGCCTATCTCGCCTTCCAAGGATAAGGGGAAAGCCAAAGCTATGGACTCGGGCAGTGAA
ACAGAAGATGAGGAAGAGGAGACTGGGTTCGTAACAGTGCAACATCCGGAGGAAGGGCGTCGACTCGACGGAAAG
AAGCCACCACTAGCCACGCCGGAGCCAACTCCTCAGCGTGGCGTCCCTCTTCCTACGCCAGCGCGCTCGGTATCT
CCACAGATTGATCTAGGAAGAGCACCTGGGAGAATCATCGGCACCACATTCCCATTGAAAGATTTCAAGAAAAAT
CTCGAACAAGGAGATGTGGTCAGCAAAGCTGTGGAGGACCTACGTGAAGTGATAGTGGAAGTGGTGATGAGACCA
TTTGCGTCCAAGAGGCATGAAGAAATGATTGATTGTCTAAGGGCCCTGAGAGATACATGCCTTAAGGAGGACGAA
ATTGATGCATGGAACGCATTTTTACCCCGTCTTAAAGAGGACTGTCTTCGTAAGAACGGTAATCCTGAATTCTGG
ATGCAAGTCAAGGACTTGGGGCGAGATATCAGTCTCATCAGTAATAAAGAAGCCAGAAAGTACGGTGGAGCTGCC
TCGGTCTCAGAGAAACGTGCAGAAGAGTTTATCGCTTGA
Gene >AgabiH97|011880
ATGTCACACTCCATTCCAAAACGTGACACCTTGCTGCGTCCACGTGATCCAATATCCCTCGTCGCGTCTGTCCCA
GTCATTCGCACTCAGACCACCATGGCAGCAGAACGAGCGGGTGTAAGTCCACCACGGACACCTTTGACGCCCTCT
AACACACACACCACCAGTACACAGTTACTATGTTTGTCGTCGATACGACACCACCCATGGGCACCCTCAAGACCA
TCGAGTTCCCAGGGCCCGAGGGGGAGACTCTTGAAAAGACCGTCACACATCTCGAATATGTCCTCCAGTTTGCCA
AGCTCAAAATACAAGAAATGGTGTGAATTTTTGACCGCATGAGACATTTGAGACCTGTGCCCAATTCCTCTGTTC
AGATCTTTAATGGCCGTAAAACCGACCAATGTGGTGTTGTCACCTTCGGCTCCCAAGGTGCTTGCCTCAAAGCCA
ATTCAACTCAACAACCTAAACGTATCTCTTTTAGTGACAAGTAACATTATCAATGAGAGGAATGGTGGCTACGAG
AATGTCGAAGAGGTATTCTCAATCGCCCAGCCTACCGCCAACCTTCTATCTAAGCTCGATTCATTGAGCACGTCC
AATGTAAAAGGGGATGGCAAGTCGTGCCCAACTCTGTGCCACATTTCTTCACTTACTTTGCCCATAGCCATGGAT
GGCTTGATTGTAGCCATTCAAACTCAAGCAGAATACCTTGGAAAAAAGAAAAGTTGGACACGCAAGATTGTCCTC
CTCACAAACGGTGAATGCCCGTTTGAACCTGAACATTGGGAGGCGGCGGTCCAGAAGATGGACGATTTTGGCGTG
TCGTTGACTGTTGTGTCAGTCCTCCATCTCAATGTCTTCAACCGACGTTAACCTTTACGCAGAGGCGTTGATTTT
GACGACCAAGAAGTTCGGTCTATGGAACCTAAAACTATTTCAAAAGTCATTGAGCCCTTTACAAGCTCTCGAAAG
CCAAGCTGACATCTTTTAGATGGAGAGCGAAAAGTTTTACCACAAACTCACCAGTTCCATGAGATCTGGGGTTGT
CGGTAACTGCACTTTCGCTCTCCAAGAAATTTCCAAACCGGATATCAAAAACGTCCGCTCGACTCTTATGGGTAA
TATTCTGCGTCTTGGAGACGTCGATACCATGGCGGAAGAGGCAATCGAAATTATTGTCAAAGCAAGTAAATGCAC
CTCCATCTCGCGGGCAAAAGCCTGGAAAAAGTTCGCCTTACGCGAGGATGATTCCGGCGAAGCCATGGTCATCGA
TGGTGATGATTCTAAAGTCGCGTTCGCCCCTCTGAGACTGCAGACCGAGTATTATGTTGACCGGAGTACCGACGA
TGAGCAAGACGCAGACGGCGATGTCAAAATGGAGGACAACGTAAATCCGCTTGATGAAAATCAAGGGGAGCGTGA
GGCAACGGACGAAGAGAAGGAAAATAACCTCGAGAAAGTAGAAAGGGAGGAGCTCGTTCGCGGATTCAAGTACGG
ATCCACGTATGTCCCTTGTCCAGACGGCCAGTTCCTCCGCCTTCCAACAAAGAAAGGCATCGATATCTGTGGGTT
TTTCCCTGTTAGCAAGGTAAGCCATATTAAATACATCACCATAGGCTAATCCATTCACTATCTACCAAGTTTCCT
CGTGAACTATCTATGGGAGAAATCCAATATATCTGGGCGGAACCTACTGACCCCCAGCAACAAGTTGCCCTTTCG
TCAATGGTACAAGCCATGCGCGAAAAGGAGTGTGTAGCCATTGCCCGCTGGGTGTCGAGAGACGATATGGACCCA
AAGATGGGAGTGCTATACCCGGAAGCCTTCGAAAGAGTAGAATGCTTTCTATGGGCACAAGTATGTTATATCTTC
TCTGATATTTCACGACTACTAACCATATAATACTAATTTTTCAGATGCCTTTCGCAGATGACATTCGCAAATACG
GCTTTGCTTCTTTGGATAAGCTAATCTCCAAGAACGGCGAAGAAATCAAAAGTCACCCTTACATACCTACTGAAT
CACAGCAAAATGCGATGGACGACTTCGTTGACGCCTTGGATTTGATGAACGCGGGCGAAAAAGATGAAGAAGGGT
ACGTTACAATACTATCGTCCTTCCATGTCTGACAATGTTTTATAATTTAGGAACCGTACACCGTGGTTCAATCCC
GCAGAGTCATACAACCCTGCACTTCATCGCACGAAGCAAGCCATGTTCCATTGTGCCGTTGTCACTGACATCGCA
AGCAATCCACTCCCACCTCCACATCCCGAGCTTCTCAAATATTTCGACCCACCCAAAAAGCTCCTCAAACGTGCC
AAACCCGCTATCGTGCAAGCACAAGAAGCATTCAAAGTCAAAGAAATACCTAAACGAGTTGTGAAACGAGGCGCT
GCAGCGAATAATAAAGGACATGAGTACGCGGCTGACGACGACGAAATGTTACTACTCAATCACAAACGCCCGAAA
TCAATCGATTCGCCGATGATGGGTGTGATCAAACTAGAGCCTATCTCGCCTTCCAAGGATAAGGGGAAAGCCAAA
GCTATGGACTCGGGCAGTGAAACAGAAGATGAGGAAGAGGAGACTGGGTTCGTAACAGTGCAACATCCGGAGGAA
GGGCGTCGACTCGACGGAAAGAAGCCACCACTAGCCACGCCGGAGCCAACTCCTCAGCGTGGCGTCCCTCTTCCT
ACGCCAGCGCGCTCGGTATCTCCACAGATTGATCTAGGAAGAGCACCTGGGAGAATCATCGGCACCACATTCCCA
TTGAAAGATTTCAAGAAAAATCTCGAACAAGGAGATGTGGTCAGCAAAGCTGTGGAGGACCTACGTGAAGTGATA
GTGGAAGTGGTGATGAGACCATTTGCGTCCAAGAGGCATGAAGAAATGATTGATTGTCTAAGGGCCCTGAGAGAT
ACATGCCTTAAGGTACAGAAATTTCAGAAATTTCATCCAATAGGGGCTAATGACCGTTTAGGAGGACGAAATTGA
TGCATGGAACGCGTAAGGCTTATCACTCCCCTTTTCCTGTTTCCGATTTTAACGGAATCTCTAGATTTTTACCCC
GTCTTAAAGAGGACTGTCTTCGTAAGAACGGTAATCCTGAATTCTGGATGCAAGTCAAGGACTTGGGGCGAGATA
TCAGTCTCATCAGTAATAAAGAAGCCAGAAAGTACGGTGGAGCTGCCTCGGTCTCAGAGAAACGTGCAGAAGAGG
TGAGTGAGAGGTATCACGCATTTATTTGCCTCGAGGCTCAAAGATTTTTCCAGTTTATCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail