Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011710
Gene name
Locationscaffold_1:2748528..2752086
Strand-
Gene length (bp)3558
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 7.3E-07 209 281
PF00013 KH_1 KH domain 1.4E-05 441 498
PF00013 KH_1 KH domain 9.4E-08 507 554
PF00013 KH_1 KH domain 1.9E-09 592 652

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07834|YL032_YEAST KH domain-containing protein YLL032C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL032C PE=1 SV=1 437 682 5.0E-18
sp|O74359|MUG60_SCHPO Meiotically up-regulated gene 60 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug60 PE=1 SV=1 394 571 1.0E-16
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 177 652 2.0E-12
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 213 655 6.0E-11
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 213 655 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07834|YL032_YEAST KH domain-containing protein YLL032C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL032C PE=1 SV=1 437 682 5.0E-18
sp|O74359|MUG60_SCHPO Meiotically up-regulated gene 60 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug60 PE=1 SV=1 394 571 1.0E-16
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 177 652 2.0E-12
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 213 655 6.0E-11
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 213 655 6.0E-11
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 176 652 8.0E-11
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 176 652 8.0E-11
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 176 652 1.0E-10
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 176 655 5.0E-10
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 213 655 5.0E-10
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 176 652 6.0E-10
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 176 632 2.0E-09
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 213 655 3.0E-09
sp|O74359|MUG60_SCHPO Meiotically up-regulated gene 60 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug60 PE=1 SV=1 177 364 3.0E-08
sp|Q24009|BICC_DROME Protein bicaudal C OS=Drosophila melanogaster GN=BicC PE=1 SV=2 184 598 2.0E-07
sp|Q9H694|BICC1_HUMAN Protein bicaudal C homolog 1 OS=Homo sapiens GN=BICC1 PE=1 SV=2 409 699 1.0E-06
sp|Q99MQ1|BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus GN=Bicc1 PE=1 SV=1 151 581 1.0E-06
sp|Q99MQ1|BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus GN=Bicc1 PE=1 SV=1 409 681 2.0E-06
sp|O59810|VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vgl1 PE=1 SV=2 509 670 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011710
MDVYTTSFVYPRRSRHSLSSASSRDLHAHDNYPHQPSPLPDTLASDADAIQKLVILAMQLHGCHVSYFIVDQGKA
YNFHITGTYQQVMLTRGLILKDCPIQHRSAIKVTRSEILDSPFSKPSLKPEVRRRLDDIASETLAHIAVVNSPLS
LTSRTPPDGITNSGGWSGLETERVCELVITGTEDAVDLARIRLLVMLDELNGLHSEVCELDHKMHPIIAGKKRHV
IQTIQEETATNIYFPSPLQGVFGTDPTGTSSGGRNNNMIWITGEFFGVQRARDMLYQVSLNKRNNTISKDTAILP
RKLDWMITDRADDLRSIMSDNSTFIQFPPLGSSTSLISVFGDSKVNVQRTIRSIMQLACQSYVGSFWLLPVQFNA
LLPPATLNTSTVTSLLNQISVATGAEVVFKSMCFEMHGLEHEVRAAVNMILELDIVKAFHHEIRFQIELANEHRE
FISGKKNGKINKIMQTTNVKIKFETFNDHNFLIDISGPDSTVIQGLSLLQEELPAEISFHVPEAYHKRIIGVGGR
SIQRIMKKYGVYVKFSNAEEFAALGGYNDNDDNVVARTPAKNAINLENLKQSVMELVNPKDKDFVNETVSIPRRY
HRTLLGEKSIFIHDIETKTNSRVRFPDKETASDVVTIYGPESQVQIAATMLLDHVPFEADMAVPPNTDLPRLCTL
PEFINLVESVKRELQVSISPNFKQTVTSNGASGTETPTDYSFKFRCQRSNSDFLITAREMLEQFLMNHNVHVYPS
PTSQGHKRGDSFADAFPHFDSKVLSTARTRGHVYAESMDINRSDVIGDRRLRLANSSPDVKALFNSPAGSYLYED
HDPSEQSYLPQGPSGGAPMDYWTQPTQMAPIGSGIPGRTRHTEDAVKRGSDPLLEAKFKDQFNKPRSLTNRAQSL
DLTYSLSKITESSSGMIPPDSPTTSTAGGDTGENSSPISGTAPSFPSVYGPPMTSAPQPTGLTTGTTVTGIPTTG
GVPSAVTVGRLSSGVGAQPGISNTSGPTMPTHQNSSRTSDDENVSKMFSNLGL*
Coding >AgabiH97|011710
ATGGATGTTTACACTACGTCCTTCGTCTATCCACGCCGGTCGCGACATAGTCTCTCCTCCGCCTCCTCTAGAGAC
CTCCATGCCCACGACAATTACCCCCACCAGCCGTCTCCTCTCCCAGACACTCTCGCCTCCGACGCTGATGCCATC
CAGAAGCTCGTCATCCTTGCTATGCAGCTCCACGGCTGCCACGTTTCGTACTTCATCGTAGACCAGGGCAAGGCT
TACAACTTTCATATTACTGGCACCTACCAGCAGGTTATGCTGACCCGTGGTCTCATTCTCAAGGACTGCCCTATC
CAGCATCGGTCTGCAATAAAAGTGACTCGTTCAGAAATCCTCGACTCTCCTTTTTCAAAACCCTCTCTCAAGCCT
GAAGTCCGACGTCGTCTTGATGATATTGCTTCTGAGACACTCGCACATATTGCCGTCGTCAACAGCCCCCTTTCC
TTGACAAGTCGAACTCCTCCCGACGGCATTACCAATAGCGGCGGATGGTCTGGCCTGGAGACAGAGCGTGTCTGC
GAACTAGTTATCACAGGAACAGAAGACGCGGTGGATCTTGCGCGTATCCGCTTGTTGGTCATGTTGGATGAGCTG
AACGGCCTTCATTCCGAAGTGTGCGAACTAGACCACAAGATGCACCCCATTATTGCAGGAAAAAAGCGCCATGTA
ATACAGACTATACAAGAGGAGACTGCCACAAATATCTATTTTCCCTCTCCGCTACAAGGAGTCTTTGGCACCGAC
CCGACCGGCACGTCATCTGGAGGGCGTAACAACAACATGATTTGGATCACAGGAGAGTTCTTTGGCGTTCAGAGG
GCGCGAGATATGTTGTATCAGGTCTCCTTGAACAAGCGCAACAACACGATCTCAAAAGACACCGCAATCCTACCG
CGCAAGCTTGATTGGATGATTACCGACCGTGCGGATGATCTTAGGTCTATCATGAGCGACAATTCGACATTTATC
CAATTTCCTCCCCTTGGGAGCTCCACTAGTCTCATATCCGTGTTTGGTGACTCAAAAGTCAATGTTCAACGGACT
ATCAGATCTATAATGCAACTTGCTTGTCAATCCTATGTTGGGTCCTTTTGGCTATTGCCCGTTCAGTTTAATGCA
CTGCTTCCACCTGCTACCCTAAATACATCTACCGTCACTTCCCTTCTTAATCAGATATCCGTTGCAACTGGCGCC
GAAGTCGTATTCAAAAGCATGTGCTTCGAGATGCACGGCTTGGAACACGAAGTGCGTGCAGCTGTCAATATGATC
CTAGAGTTAGACATTGTGAAGGCCTTCCACCACGAGATTCGTTTTCAAATCGAGTTGGCCAACGAACACCGAGAA
TTTATTAGTGGCAAGAAGAACGGCAAAATTAATAAGATCATGCAAACTACGAATGTGAAAATCAAATTTGAAACT
TTCAACGACCATAATTTCCTCATCGATATCTCGGGCCCCGACAGCACCGTTATCCAGGGACTATCTCTTCTCCAA
GAAGAGCTCCCTGCCGAAATATCATTCCATGTACCCGAAGCATACCACAAACGGATTATTGGTGTGGGAGGTCGA
AGCATTCAGCGTATCATGAAAAAATATGGCGTTTATGTTAAATTTTCCAACGCCGAGGAGTTTGCTGCACTGGGT
GGTTATAATGACAATGACGACAATGTCGTGGCCCGGACGCCCGCCAAAAATGCGATCAATCTCGAAAATTTAAAA
CAGTCGGTGATGGAGCTTGTCAACCCCAAAGACAAAGATTTCGTAAATGAAACTGTGTCTATTCCCCGAAGATAT
CATAGAACATTATTGGGCGAGAAAAGTATTTTTATTCATGATATTGAGACGAAGACTAACTCCCGGGTGCGATTT
CCTGATAAAGAAACGGCTTCAGATGTGGTTACCATCTATGGCCCCGAGAGCCAAGTGCAAATTGCGGCTACAATG
CTCCTGGACCACGTACCATTCGAAGCAGATATGGCAGTACCACCTAACACTGATCTGCCCCGACTCTGCACATTA
CCTGAATTCATCAACCTCGTGGAAAGCGTCAAGCGCGAGCTTCAAGTTTCCATCTCTCCCAACTTTAAACAAACC
GTCACTAGTAATGGTGCATCGGGTACGGAGACTCCCACCGACTACTCCTTCAAATTTAGGTGTCAGCGTAGCAAC
AGCGATTTCCTTATTACTGCGCGCGAGATGTTGGAACAGTTCCTAATGAACCACAACGTCCATGTCTATCCTTCT
CCAACATCTCAAGGCCACAAGCGAGGTGACTCTTTTGCAGATGCATTCCCCCATTTCGATAGCAAAGTTCTTTCC
ACGGCTCGGACTCGCGGCCATGTTTACGCAGAGTCTATGGACATAAACCGGTCAGATGTTATCGGCGATAGGAGG
CTTCGTCTTGCGAATTCGTCTCCTGACGTGAAGGCCTTGTTCAATTCGCCTGCCGGTTCTTACCTCTACGAAGAT
CACGATCCCTCAGAGCAGAGTTACTTGCCTCAGGGCCCGTCGGGTGGGGCTCCGATGGATTATTGGACACAGCCA
ACCCAAATGGCGCCTATCGGATCCGGTATACCAGGACGCACGCGACATACAGAAGACGCGGTCAAGCGGGGTTCA
GATCCACTTCTTGAAGCTAAATTCAAGGACCAGTTCAATAAGCCACGTTCCTTGACAAATCGTGCTCAGTCTCTT
GATCTGACGTACTCCCTTTCCAAAATCACTGAATCGAGTTCTGGCATGATCCCACCAGACTCTCCGACTACCTCT
ACTGCAGGTGGTGACACTGGTGAAAATTCGAGTCCTATCTCTGGAACCGCGCCATCATTTCCCAGTGTGTACGGT
CCGCCCATGACTTCTGCACCTCAACCGACTGGCTTGACGACCGGTACTACTGTAACTGGAATCCCCACGACTGGC
GGTGTACCTTCTGCAGTTACCGTCGGGAGGCTGTCTAGTGGTGTCGGGGCGCAGCCTGGAATTTCCAATACGAGT
GGTCCAACGATGCCTACGCATCAAAATTCTAGTCGAACGTCCGATGATGAAAATGTCTCGAAGATGTTTTCTAAC
CTTGGATTGTAA
Transcript >AgabiH97|011710
ATGGATGTTTACACTACGTCCTTCGTCTATCCACGCCGGTCGCGACATAGTCTCTCCTCCGCCTCCTCTAGAGAC
CTCCATGCCCACGACAATTACCCCCACCAGCCGTCTCCTCTCCCAGACACTCTCGCCTCCGACGCTGATGCCATC
CAGAAGCTCGTCATCCTTGCTATGCAGCTCCACGGCTGCCACGTTTCGTACTTCATCGTAGACCAGGGCAAGGCT
TACAACTTTCATATTACTGGCACCTACCAGCAGGTTATGCTGACCCGTGGTCTCATTCTCAAGGACTGCCCTATC
CAGCATCGGTCTGCAATAAAAGTGACTCGTTCAGAAATCCTCGACTCTCCTTTTTCAAAACCCTCTCTCAAGCCT
GAAGTCCGACGTCGTCTTGATGATATTGCTTCTGAGACACTCGCACATATTGCCGTCGTCAACAGCCCCCTTTCC
TTGACAAGTCGAACTCCTCCCGACGGCATTACCAATAGCGGCGGATGGTCTGGCCTGGAGACAGAGCGTGTCTGC
GAACTAGTTATCACAGGAACAGAAGACGCGGTGGATCTTGCGCGTATCCGCTTGTTGGTCATGTTGGATGAGCTG
AACGGCCTTCATTCCGAAGTGTGCGAACTAGACCACAAGATGCACCCCATTATTGCAGGAAAAAAGCGCCATGTA
ATACAGACTATACAAGAGGAGACTGCCACAAATATCTATTTTCCCTCTCCGCTACAAGGAGTCTTTGGCACCGAC
CCGACCGGCACGTCATCTGGAGGGCGTAACAACAACATGATTTGGATCACAGGAGAGTTCTTTGGCGTTCAGAGG
GCGCGAGATATGTTGTATCAGGTCTCCTTGAACAAGCGCAACAACACGATCTCAAAAGACACCGCAATCCTACCG
CGCAAGCTTGATTGGATGATTACCGACCGTGCGGATGATCTTAGGTCTATCATGAGCGACAATTCGACATTTATC
CAATTTCCTCCCCTTGGGAGCTCCACTAGTCTCATATCCGTGTTTGGTGACTCAAAAGTCAATGTTCAACGGACT
ATCAGATCTATAATGCAACTTGCTTGTCAATCCTATGTTGGGTCCTTTTGGCTATTGCCCGTTCAGTTTAATGCA
CTGCTTCCACCTGCTACCCTAAATACATCTACCGTCACTTCCCTTCTTAATCAGATATCCGTTGCAACTGGCGCC
GAAGTCGTATTCAAAAGCATGTGCTTCGAGATGCACGGCTTGGAACACGAAGTGCGTGCAGCTGTCAATATGATC
CTAGAGTTAGACATTGTGAAGGCCTTCCACCACGAGATTCGTTTTCAAATCGAGTTGGCCAACGAACACCGAGAA
TTTATTAGTGGCAAGAAGAACGGCAAAATTAATAAGATCATGCAAACTACGAATGTGAAAATCAAATTTGAAACT
TTCAACGACCATAATTTCCTCATCGATATCTCGGGCCCCGACAGCACCGTTATCCAGGGACTATCTCTTCTCCAA
GAAGAGCTCCCTGCCGAAATATCATTCCATGTACCCGAAGCATACCACAAACGGATTATTGGTGTGGGAGGTCGA
AGCATTCAGCGTATCATGAAAAAATATGGCGTTTATGTTAAATTTTCCAACGCCGAGGAGTTTGCTGCACTGGGT
GGTTATAATGACAATGACGACAATGTCGTGGCCCGGACGCCCGCCAAAAATGCGATCAATCTCGAAAATTTAAAA
CAGTCGGTGATGGAGCTTGTCAACCCCAAAGACAAAGATTTCGTAAATGAAACTGTGTCTATTCCCCGAAGATAT
CATAGAACATTATTGGGCGAGAAAAGTATTTTTATTCATGATATTGAGACGAAGACTAACTCCCGGGTGCGATTT
CCTGATAAAGAAACGGCTTCAGATGTGGTTACCATCTATGGCCCCGAGAGCCAAGTGCAAATTGCGGCTACAATG
CTCCTGGACCACGTACCATTCGAAGCAGATATGGCAGTACCACCTAACACTGATCTGCCCCGACTCTGCACATTA
CCTGAATTCATCAACCTCGTGGAAAGCGTCAAGCGCGAGCTTCAAGTTTCCATCTCTCCCAACTTTAAACAAACC
GTCACTAGTAATGGTGCATCGGGTACGGAGACTCCCACCGACTACTCCTTCAAATTTAGGTGTCAGCGTAGCAAC
AGCGATTTCCTTATTACTGCGCGCGAGATGTTGGAACAGTTCCTAATGAACCACAACGTCCATGTCTATCCTTCT
CCAACATCTCAAGGCCACAAGCGAGGTGACTCTTTTGCAGATGCATTCCCCCATTTCGATAGCAAAGTTCTTTCC
ACGGCTCGGACTCGCGGCCATGTTTACGCAGAGTCTATGGACATAAACCGGTCAGATGTTATCGGCGATAGGAGG
CTTCGTCTTGCGAATTCGTCTCCTGACGTGAAGGCCTTGTTCAATTCGCCTGCCGGTTCTTACCTCTACGAAGAT
CACGATCCCTCAGAGCAGAGTTACTTGCCTCAGGGCCCGTCGGGTGGGGCTCCGATGGATTATTGGACACAGCCA
ACCCAAATGGCGCCTATCGGATCCGGTATACCAGGACGCACGCGACATACAGAAGACGCGGTCAAGCGGGGTTCA
GATCCACTTCTTGAAGCTAAATTCAAGGACCAGTTCAATAAGCCACGTTCCTTGACAAATCGTGCTCAGTCTCTT
GATCTGACGTACTCCCTTTCCAAAATCACTGAATCGAGTTCTGGCATGATCCCACCAGACTCTCCGACTACCTCT
ACTGCAGGTGGTGACACTGGTGAAAATTCGAGTCCTATCTCTGGAACCGCGCCATCATTTCCCAGTGTGTACGGT
CCGCCCATGACTTCTGCACCTCAACCGACTGGCTTGACGACCGGTACTACTGTAACTGGAATCCCCACGACTGGC
GGTGTACCTTCTGCAGTTACCGTCGGGAGGCTGTCTAGTGGTGTCGGGGCGCAGCCTGGAATTTCCAATACGAGT
GGTCCAACGATGCCTACGCATCAAAATTCTAGTCGAACGTCCGATGATGAAAATGTCTCGAAGATGTTTTCTAAC
CTTGGATTGTAA
Gene >AgabiH97|011710
ATGGATGTTTACACTACGTCCTTCGTCTATCCACGCCGGTCGCGACATAGTCTCTCCTCCGCCTCCTCTAGAGAC
CTCCATGCCCACGACAATTACCCCCACCAGCCGTCTCCTCTCCCAGACACTCTCGCCTCCGACGCTGATGCCATC
CAGAAGCTCGTCATCCTTGCTATGCAGCTCCACGGCTGCCACGTTTCGTACTTCATCGTAGACCAGGGCAAGGCT
TACAACTTTCATATTACTGGCACCTACCAGCAGGTTATGCTGACCCGTGGTCTCATTCTCAAGGACTGCCCTATC
CAGGTCTCTTAATTTCTGTCCCGTCAAACGTCGTGAGCTGACTTCTGGTCTGCCCCTCCAGCATCGGTCTGCAAT
AAAAGTGACTCGTTCAGAAATCCTCGACTCTCCTTTTTCAAAACCCTCTCTCAAGCCTGAAGTCCGACGTCGTCT
TGATGATATTGCTTCTGAGACACTCGCACATATTGCCGTCGTCAACAGCCCCCTTTCCTTGACAAGTCGAACTCC
TCCCGACGGCATTACCAATAGCGGCGGATGGTCTGGCCTGGAGACAGAGCGTGTCTGCGAACTAGTTATCACAGG
AACAGAAGACGCGGTGGATCTTGCGCGTATCCGCTTGTTGGTCATGTTGGATGAGCTGGTCAGTCGAGATCTCTT
TTGCCGATCCGTAGACTAATCTTTTTGCAGAACGGCCTTCATTCCGAAGTGTGCGAACTAGACCACAAGATGCAC
CCCATTATTGCAGGAAAAAAGCGCCATGTAATACAGACTATACAAGAGGAGACTGCCACAAATATCTATTTTCCC
TCTCCGCTACAAGGAGTCTTTGGCACCGACCCGACCGGCACGTCATCTGGAGGGCGTAACAACAACATGATTTGG
ATCACAGGAGAGTTCTTTGGCGTTCAGAGGGCGCGAGATATGTTGTATCAGGTCTCCTTGAACAAGGTGCGTAAT
GTCTCCACTCGTGTCTAGGACCAATATTCACATGCAGATAGCGCAACAACACGATCTCAAAAGACACCGCAATCC
TACCGCGCAAGCTTGATTGGATGATTACCGACCGTGCGGATGATCTTAGGTCTATCATGAGCGACAATTCGACAT
TTATCCAATTTCCTCCCCTTGGGAGCTCCACTAGTCTCATATCCGTGTTTGGTGACTCAAAAGTCAATGTTCAAC
GGACTATCAGATCTATAATGCAACTTGTGCGTTTGTTTGTCACGACTTTCCTGAACATATTGTCGAGGCTCTTTT
CTAGGCTTGTCAATCCTATGTTGGGTCCTTTTGGCTATTGCCCGTTCAGTTTAATGCACTGCTTCCACCTGCTAC
CCTAAATACATCTACCGTCACTTCCCTTCTTAATCAGATATCCGTTGCAACTGGCGCCGAAGTCGTATTCAAAAG
CATGTGCTTCGAGATGCACGGCTTGGAACACGAAGTGCGTGCAGCTGTCAATATGATCCTAGAGTTAGACATTGT
GAAGGTACGCTCTGCTCCGTTGACTTACGTACTTCACCTCCTTAACCTGTTCTATAGGCCTTCCACCACGAGATT
CGTTTTCAAATCGAGTTGGCCAACGAACACCGAGAATTTATTAGTGGCAAGAAGAACGGCAAAATTAATAAGATC
ATGCAAACTACGAATGTGAAAATCAAATTTGAAACTTTCAACGACCATAATTTCCTCATCGATATCTCGGGCCCC
GACAGCACCGTTATCCAGGGACTATCTCTTCTCCAAGAAGAGCTCCCTGCCGAAATATCATTCCATGTACCCGAA
GCATACCACAAACGGATTATTGGTGTGGGAGGTCGAAGCATTCAGCGTATCATGAAAAAATATGGCGTTTATGTT
AAATTTTCCAACGCCGAGGAGTTTGCTGCACTGGGTGGTTATAATGACAATGACGACAATGTCGTGGCCCGGACG
CCCGCCAAAAATGCGATCAATCTCGAAAATTTAAAACAGTCGGTGATGGAGCTTGTCAACCCCAAAGTACGTTGC
GTTGTCATCACGCTCATGGCACTCCTTTGACTTTCATGGAAGGACAAAGATTTCGTAAATGAAACTGTGTCTATT
CCCCGAAGATATCATAGAACATTATTGGGCGAGAAAAGTATTTTTATTCATGATATTGAGACGAAGACTAACTCC
CGGGTGCGATTTCCTGATAAAGAAACGGCTTCAGATGTGGTTACCATCTATGGCCCCGAGAGCCAAGTGCAAATT
GCGGCTACAATGCTCCTGGTTAGTGTTGCCATTACTGATGCTTTAAATGGTGCCTCATTTTCAATAGGACCACGT
ACCATTCGAAGCAGATATGGCAGTACCACCTAACACTGATCTGCCCCGACTCTGCACATTACCTGAATTCATCAA
CCTCGTGGAAAGCGTCAAGCGCGAGCTTCAAGTTTCCATCTCTCCCAACTTTAAACAAACCGTCACTAGTAATGG
TGCATCGGGTACGGAGACTCCCACCGACTACTCCTTCAAATTTAGGTGTCAGCGTAGCAACAGCGATTTCCTTAT
TACTGCGCGCGAGATGTTGGAACAGTTCCTAATGAACCACAACGTCCATGTCTATCCTTCTCCAACATCTCAAGG
CCACAAGCGAGGTGACTCTTTTGCAGATGCATTCCCCCATTTCGATAGCAAAGTTCTTTCCACGGCTCGGACTCG
CGGCCATGGTAAGCTTTGGGCTTACTAACTCCTCCGATTGTCTAAGTTTTCTTTTCGCAGTTTACGCAGAGTCTA
TGGACATAAACCGGTCAGATGTTATCGGCGATAGGAGGCTTCGTCTTGCGAATTCGTCTCCTGACGTGAAGGCCT
TGTTCAATTCGCCTGCCGGTTCTTACCTCTACGAAGATCACGATCCCTCAGAGCAGAGTTACTTGCCTCAGGGCC
CGTCGGGTGGGGCTCCGATGGATTATTGGACACAGCCAACCCAAATGGCGCCTATCGTAAGTTACTATCGCCGTT
GAGTTGATGGCGTGACCTAACCCTTAATTTTAAAATTAGGGATCCGGTATACCAGGACGCACGCGACATACAGAA
GACGCGGTCAAGCGGGGTTCAGATCCACTTCTTGAAGCTAAATTCAAGGACCAGTTCAATAAGCCACGTTCCTTG
ACAAATCGTGCTCAGTCTCTTGATCTGACGTACTCCCTTTCCAAAATCACTGAATCGAGTTCTGGCATGATCCCA
CCAGACTCTCCGACTACCTCTACTGCAGGTGGTGACACTGGTGAAAATTCGAGTCCTATCTCTGGAACCGCGCCA
TCATTTCCCAGTGTGTACGGTCCGCCCATGACTTCTGCACCTCAACCGACTGGCTTGACGACCGGTACTACTGTA
ACTGGAATCCCCACGACTGGCGGTGTACCTTCTGCAGTTACCGTCGGGAGGCTGTCTAGTGGTGTCGGGGCGCAG
CCTGGAATTTCCAATACGAGTGGTCCAACGATGCCTACGCATCAAAATTCTAGTCGAACGTCCGATGATGAAAAT
GTCTCGAAGATGTTTTCTAACCTTGGATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail