Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011660
Gene name
Locationscaffold_1:2740719..2741547
Strand+
Gene length (bp)828
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 1.2E-29 17 156

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4WCX9|YA280_ASPFU Uncharacterized protein AFUA_6G02800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G02800 PE=1 SV=1 1 156 1.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011660
MKVVSALIVPTLALAVNAHFHLQSPEPRGPFVAASEPNFCDDYTHVTENRTDFPLNGGIISMNTGHPKWSAAIFI
STDADPDSFDKFEQVNTFFQLEGEGDFCIPLNLASSNATGLQEGQNATIQVLFDGGDGALFQCADVTLTSDASSI
SCTNSTSSDSDTSGDSGSTGEDSGALGLTLNTNVLLGVLGLASLIPLMA*
Coding >AgabiH97|011660
ATGAAGGTCGTCTCCGCACTTATCGTCCCTACTCTTGCCTTGGCAGTAAATGCACATTTCCACCTCCAGTCTCCA
GAGCCCCGCGGTCCCTTCGTAGCGGCTTCAGAACCCAATTTTTGTGATGACTACACACATGTCACCGAAAACCGC
ACCGATTTTCCACTAAACGGAGGTATCATCTCCATGAACACTGGGCACCCAAAATGGAGTGCTGCGATTTTCATA
TCTACCGATGCGGACCCTGACAGCTTCGACAAATTCGAACAAGTCAACACGTTCTTCCAGCTCGAGGGAGAAGGA
GATTTTTGTATTCCATTGAATCTCGCTTCATCCAACGCTACTGGACTTCAGGAAGGACAGAATGCGACTATTCAG
GTGCTATTTGATGGAGGGGATGGCGCACTATTCCAGTGCGCCGATGTAACGCTGACCAGCGACGCAAGCAGTATC
AGCTGTACAAATTCCACTTCGTCGGACTCAGACACCAGTGGAGATTCTGGTTCTACCGGTGAAGATTCTGGGGCC
TTAGGCTTGACCCTCAACACGAATGTGTTACTCGGAGTACTGGGTTTAGCATCGTTGATTCCTCTCATGGCGTGA
Transcript >AgabiH97|011660
ATGAAGGTCGTCTCCGCACTTATCGTCCCTACTCTTGCCTTGGCAGTAAATGCACATTTCCACCTCCAGTCTCCA
GAGCCCCGCGGTCCCTTCGTAGCGGCTTCAGAACCCAATTTTTGTGATGACTACACACATGTCACCGAAAACCGC
ACCGATTTTCCACTAAACGGAGGTATCATCTCCATGAACACTGGGCACCCAAAATGGAGTGCTGCGATTTTCATA
TCTACCGATGCGGACCCTGACAGCTTCGACAAATTCGAACAAGTCAACACGTTCTTCCAGCTCGAGGGAGAAGGA
GATTTTTGTATTCCATTGAATCTCGCTTCATCCAACGCTACTGGACTTCAGGAAGGACAGAATGCGACTATTCAG
GTGCTATTTGATGGAGGGGATGGCGCACTATTCCAGTGCGCCGATGTAACGCTGACCAGCGACGCAAGCAGTATC
AGCTGTACAAATTCCACTTCGTCGGACTCAGACACCAGTGGAGATTCTGGTTCTACCGGTGAAGATTCTGGGGCC
TTAGGCTTGACCCTCAACACGAATGTGTTACTCGGAGTACTGGGTTTAGCATCGTTGATTCCTCTCATGGCGTGA
Gene >AgabiH97|011660
ATGAAGGTCGTCTCCGCACTTATCGTCCCTACTCTTGCCTTGGCAGTAAATGCACATTTCCACCTCCAGTCTCCA
GAGCCCCGCGGTCCCTTCGTAGCGGCTTCAGAACCCAATTTTTGTGGTATGTTGTCGTAAAACAACAACGGCAAG
ATTGAACAAGATATTTACTGTTCCCTGCTGATAGATGACTACACACATGTCACCGAAAACCGCACCGATTTTCCA
CTAAACGGAGGTATCATCTCCATGAACACTGGGCACCCAAAATGGAGTGGTGAGTGACCATTTTCTGACATATGA
ATGACAATTGTTCATGCTGGACGACAATTAGCTGCGATTTTCATATCTACCGATGCGGACCCTGACAGCTTCGAC
AAATTCGAACAAGTCAACACGTTCTTCCAGCTCGAGGGAGAAGGAGATTTTTGTATTCCATTGAATCTCGCTTCA
TCCAACGCTACTGGACTTCAGGAAGGACAGAATGCGACTATTCAGGTAATTGATAATTCCCCTGAGCCAGTTGAT
CTTACCCGCTTACTACGTATAAACAAGGTGCTATTTGATGGAGGGGATGGCGCACTATTCCAGGTAAGTGTCAGC
CACTATTTACATTTCTGCGGCTCATCTGAAATCTCTCAGTGCGCCGATGTAACGCTGACCAGCGACGCAAGCAGT
ATCAGCTGTACAAATTCCACTTCGTCGGACTCAGACACCAGTGGAGATTCTGGTTCTACCGGTGAAGATTCTGGG
GCCTTAGGCTTGACCCTCAACACGAATGTGTTACTCGGAGTACTGGGTTTAGCATCGTTGATTCCTCTCATGGCG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail