Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011570
Gene name
Locationscaffold_1:2728082..2729692
Strand+
Gene length (bp)1610
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01585 G-patch G-patch domain 4.8E-11 86 127
PF12656 G-patch_2 G-patch domain 2.3E-06 89 130
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 1.3E-05 183 207
PF12874 zf-met Zinc-finger of C2H2 type 3.6E-04 183 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus GN=Gpatch8 PE=1 SV=1 60 305 1.0E-33
sp|Q9UKJ3|GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens GN=GPATCH8 PE=1 SV=2 60 298 2.0E-32
sp|Q6DF57|GPT11_XENTR G patch domain-containing protein 11 OS=Xenopus tropicalis GN=gpatch11 PE=2 SV=1 83 191 4.0E-11
sp|Q2KI19|GPT11_BOVIN G patch domain-containing protein 11 OS=Bos taurus GN=GPATCH11 PE=2 SV=2 77 162 6.0E-10
sp|Q3UFS4|GPT11_MOUSE G patch domain-containing protein 11 OS=Mus musculus GN=Gpatch11 PE=1 SV=2 77 144 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus GN=Gpatch8 PE=1 SV=1 60 305 1.0E-33
sp|Q9UKJ3|GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens GN=GPATCH8 PE=1 SV=2 60 298 2.0E-32
sp|Q6DF57|GPT11_XENTR G patch domain-containing protein 11 OS=Xenopus tropicalis GN=gpatch11 PE=2 SV=1 83 191 4.0E-11
sp|Q2KI19|GPT11_BOVIN G patch domain-containing protein 11 OS=Bos taurus GN=GPATCH11 PE=2 SV=2 77 162 6.0E-10
sp|Q3UFS4|GPT11_MOUSE G patch domain-containing protein 11 OS=Mus musculus GN=Gpatch11 PE=1 SV=2 77 144 1.0E-09
sp|Q6DGZ0|GPT11_DANRE G patch domain-containing protein 11 OS=Danio rerio GN=gpatch11 PE=2 SV=1 79 144 2.0E-09
sp|Q8N954|GPT11_HUMAN G patch domain-containing protein 11 OS=Homo sapiens GN=GPATCH11 PE=1 SV=3 77 162 8.0E-09
sp|A2AKY4|Z804A_MOUSE Zinc finger protein 804A OS=Mus musculus GN=Znf804a PE=2 SV=1 162 266 2.0E-08
sp|Q7Z570|Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens GN=ZNF804A PE=1 SV=3 162 266 3.0E-08
sp|A4D1E1|Z804B_HUMAN Zinc finger protein 804B OS=Homo sapiens GN=ZNF804B PE=2 SV=2 182 267 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011570
MSESSIARRNAVPMARTQDTDVTLKRKRQDDEMDEDDDDVSPVSRSPSPDSGAMDVDPSDHISKYDEFIHKPVHE
TITVESKIKSTNKGFALLAKMGWSEGQPVGLSGDGRVDPIPFEIKYDSTGLGKTTQDVRMIEETVSQRRGLDSER
QTRETEEQRRAREDTVARQAAVKDEVSNAIRSFYCMLCDKQFQNVAQYDEHTNSYAHHHKARFKDMQANARPKAQ
EEIDRRKEKERKREERELRKIAAAAGIKVPKVTPAVPAPTPAAVTPVGVSAESDGTPSEKKRGWASVGDTSAAVP
TSTGFKKSGWATVGSSSTPQPSQTSDQAKSSNWAPAPSASIPPQPPMTSRHTSHTPSFRTGGWTSLDTTSDTVNP
PPPPPPAAHSYPYSAPPMQPSSPPPPPPPSSSHTVSGGRGGWSTSSATHASATPRQSEGLEIPTPTPDSIMSAPT
PKPLSNPPAVPVRSGWQKFQAKNNKRK*
Coding >AgabiH97|011570
ATGTCCGAGAGCTCAATAGCTCGCCGGAACGCCGTACCCATGGCTCGGACTCAGGATACAGATGTCACCCTAAAG
CGCAAGAGGCAGGACGACGAGATGGACGAAGATGACGACGATGTATCTCCCGTCTCGCGCTCTCCCTCTCCCGAT
AGCGGAGCTATGGACGTTGATCCAAGCGACCATATCTCCAAGTATGATGAATTCATTCACAAACCCGTCCACGAG
ACTATCACAGTCGAAAGCAAGATAAAATCCACCAACAAGGGTTTTGCCCTCCTTGCCAAGATGGGTTGGTCGGAG
GGTCAGCCGGTCGGACTCTCGGGAGATGGTCGTGTGGATCCTATCCCATTTGAAATCAAGTACGACTCCACTGGG
CTTGGTAAAACAACACAGGATGTCCGTATGATTGAAGAAACTGTCTCTCAACGTCGCGGGCTTGATTCTGAACGC
CAAACGAGAGAAACAGAGGAACAGCGGAGGGCTCGTGAGGATACTGTCGCGCGCCAAGCGGCGGTCAAAGATGAG
GTATCCAACGCAATCCGCTCTTTTTACTGCATGCTTTGCGACAAACAATTCCAAAACGTTGCTCAATATGATGAA
CACACTAATTCCTATGCGCATCACCACAAGGCCAGATTCAAAGACATGCAAGCCAATGCCAGACCGAAGGCCCAA
GAAGAAATCGATAGGCGGAAAGAGAAGGAACGCAAGCGTGAAGAACGCGAACTACGCAAGATCGCAGCCGCAGCC
GGTATCAAGGTACCAAAGGTGACTCCGGCGGTGCCTGCGCCTACGCCTGCCGCAGTCACTCCTGTGGGTGTATCC
GCCGAATCTGACGGGACTCCGAGCGAAAAGAAAAGAGGTTGGGCATCCGTCGGTGATACCTCTGCAGCGGTTCCT
ACATCTACTGGTTTCAAGAAGTCGGGTTGGGCGACTGTTGGCTCGTCGTCAACGCCACAACCTTCACAAACATCT
GACCAAGCGAAATCTTCAAATTGGGCGCCAGCGCCATCTGCATCTATACCTCCGCAGCCTCCGATGACTTCGCGT
CATACAAGCCATACACCATCTTTTCGAACGGGAGGATGGACCTCACTTGATACCACAAGTGATACTGTCAATCCA
CCTCCACCTCCACCACCCGCCGCTCATTCATATCCGTATTCAGCACCACCAATGCAACCGTCCTCGCCACCGCCG
CCACCTCCTCCATCGTCATCACACACTGTATCAGGAGGTAGGGGTGGATGGTCAACCTCATCTGCGACACACGCT
TCTGCTACTCCACGCCAGTCTGAAGGACTCGAAATCCCTACTCCTACGCCTGACTCCATTATGTCCGCACCTACG
CCGAAACCTTTGTCTAATCCGCCCGCGGTGCCCGTACGTTCAGGTTGGCAAAAGTTTCAGGCGAAAAACAATAAA
AGAAAATGA
Transcript >AgabiH97|011570
ATGTCCGAGAGCTCAATAGCTCGCCGGAACGCCGTACCCATGGCTCGGACTCAGGATACAGATGTCACCCTAAAG
CGCAAGAGGCAGGACGACGAGATGGACGAAGATGACGACGATGTATCTCCCGTCTCGCGCTCTCCCTCTCCCGAT
AGCGGAGCTATGGACGTTGATCCAAGCGACCATATCTCCAAGTATGATGAATTCATTCACAAACCCGTCCACGAG
ACTATCACAGTCGAAAGCAAGATAAAATCCACCAACAAGGGTTTTGCCCTCCTTGCCAAGATGGGTTGGTCGGAG
GGTCAGCCGGTCGGACTCTCGGGAGATGGTCGTGTGGATCCTATCCCATTTGAAATCAAGTACGACTCCACTGGG
CTTGGTAAAACAACACAGGATGTCCGTATGATTGAAGAAACTGTCTCTCAACGTCGCGGGCTTGATTCTGAACGC
CAAACGAGAGAAACAGAGGAACAGCGGAGGGCTCGTGAGGATACTGTCGCGCGCCAAGCGGCGGTCAAAGATGAG
GTATCCAACGCAATCCGCTCTTTTTACTGCATGCTTTGCGACAAACAATTCCAAAACGTTGCTCAATATGATGAA
CACACTAATTCCTATGCGCATCACCACAAGGCCAGATTCAAAGACATGCAAGCCAATGCCAGACCGAAGGCCCAA
GAAGAAATCGATAGGCGGAAAGAGAAGGAACGCAAGCGTGAAGAACGCGAACTACGCAAGATCGCAGCCGCAGCC
GGTATCAAGGTACCAAAGGTGACTCCGGCGGTGCCTGCGCCTACGCCTGCCGCAGTCACTCCTGTGGGTGTATCC
GCCGAATCTGACGGGACTCCGAGCGAAAAGAAAAGAGGTTGGGCATCCGTCGGTGATACCTCTGCAGCGGTTCCT
ACATCTACTGGTTTCAAGAAGTCGGGTTGGGCGACTGTTGGCTCGTCGTCAACGCCACAACCTTCACAAACATCT
GACCAAGCGAAATCTTCAAATTGGGCGCCAGCGCCATCTGCATCTATACCTCCGCAGCCTCCGATGACTTCGCGT
CATACAAGCCATACACCATCTTTTCGAACGGGAGGATGGACCTCACTTGATACCACAAGTGATACTGTCAATCCA
CCTCCACCTCCACCACCCGCCGCTCATTCATATCCGTATTCAGCACCACCAATGCAACCGTCCTCGCCACCGCCG
CCACCTCCTCCATCGTCATCACACACTGTATCAGGAGGTAGGGGTGGATGGTCAACCTCATCTGCGACACACGCT
TCTGCTACTCCACGCCAGTCTGAAGGACTCGAAATCCCTACTCCTACGCCTGACTCCATTATGTCCGCACCTACG
CCGAAACCTTTGTCTAATCCGCCCGCGGTGCCCGTACGTTCAGGTTGGCAAAAGTTTCAGGCGAAAAACAATAAA
AGAAAATGA
Gene >AgabiH97|011570
ATGTCCGAGAGCTCAATAGCTCGCCGGAACGCCGTACCCATGGCTCGGACTCAGGATACAGATGTCACCCTAAAG
GTACTCTACCAGCTCTTTTTCTCCCCGGCATATCCCCTCCTACCCTGTTCCCATATCCCAGCGCAAGAGGCAGGA
CGACGAGATGGACGAAGATGACGACGATGTATCTCCCGTCTCGCGCTCTCCCTCTCCCGATAGCGGAGCTATGGA
CGTTGATCCAAGCGACCATATCTCCAAGTATGATGAATTCATTCACAAACCCGTCCACGAGACTATCACAGTCGA
AAGCAAGATAAAATCCACCAACAAGGGTTTTGCCCTCCTTGCCAAGATGGGTTGGTCGGAGGGTCAGCCGGTCGG
ACTCTCGGGAGATGGCACGTCACCATTAATTATTTCATCTTGGTCCTTGTTTAATCATACAATATGAAGGTCGTG
TGGATCCTATCCCATTTGAAATCAAGTACGACTCCACTGGGCTTGGTAAAACAACACAGGATGTCCGTATGATTG
AAGAAACTGTCTCTCAACGTCGCGGGCTTGATTCTGAACGCCAAACGAGAGAAACAGAGGAACAGCGGAGGGCTC
GTGAGGTATACCTTCCTTGTCCTATGTACAGTCTAAAATGATCATCTGATCCTATAATAAACCAGGATACTGTCG
CGCGCCAAGCGGCGGTCAAAGATGAGGTATCCAACGCAATCCGCTCTTTTTACTGCATGCTTTGCGACAAACAAT
TCCAAAACGTTGCTCAATATGATGAACACACTAATTCCTATGCGCATCACCACAAGGCCAGATTCAAAGACATGC
AAGCCAATGCCAGACCGAAGGCCCAAGAAGAAATCGATAGGCGGAAAGAGAAGGAACGCAAGCGTGAAGAACGCG
AACTACGCAAGATCGCAGCCGCAGCCGGTATCAAGGTACCAAAGGTGACTCCGGCGGTGCCTGCGCCTACGCCTG
CCGCAGTCACTCCTGTGGGTGTATCCGCCGAATCTGACGGGACTCCGAGCGAAAAGAAAAGAGGTTGGGCATCCG
TCGGTGATACCTCTGCAGCGGTTCCTACATCTACTGGTTTCAAGAAGTCGGGTTGGGCGACTGTTGGCTCGTCGT
CAACGCCACAACCTTCACAAACATCTGACCAAGCGAAATCTTCAAATTGGGCGCCAGCGCCATCTGCATCTATAC
CTCCGCAGCCTCCGATGACTTCGCGTCATACAAGCCATACACCATCTTTTCGAACGGGAGGATGGACCTCACTTG
ATACCACAAGTGATACTGTCAATCCACCTCCACCTCCACCACCCGCCGCTCATTCATATCCGTATTCAGCACCAC
CAATGCAACCGTCCTCGCCACCGCCGCCACCTCCTCCATCGTCATCACACACTGTATCAGGAGGTAGGGGTGGAT
GGTCAACCTCATCTGCGACACACGCTTCTGCTACTCCACGCCAGTCTGAAGGACTCGAAATCCCTACTCCTACGC
CTGACTCCATTATGTCCGCACCTACGCCGAAACCTTTGTCTAATCCGCCCGCGGTGCCCGTACGTTCAGGTTGGC
AAAAGTTTCAGGCGAAAAACAATAAAAGAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail