Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011530
Gene name
Locationscaffold_1:2717018..2719590
Strand-
Gene length (bp)2572
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.3E-10 208 465

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 262 542 4.0E-12

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 151 173 22
3 209 226 17
4 231 253 22
5 266 288 22
6 293 315 22
7 376 393 17
8 416 438 22
9 450 472 22
10 487 509 22
11 516 538 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011530
MARAEPVFLDDVALVDRQQKDSSSDISIKESTPAPPPTPQSLTPLPGAQIHERATVIVPSPCNPALPIPRIHDPV
SPLSAISLSTAQSPILASGQEEATHLQHRFRTLGWRLASGYFACFILSWADGVTGTVLPYLKAEFNLSTMTLSLL
WGGGTCGYFAGTLLVESILRWLGHFNFDIELSKSVDHSSLVASDKNTRNIGHSASRARHLTLLMGSVLHAIFFAM
MGSKSGFPVMFVAYAVAAFARAVLNAILNSYFASGPKQALGYAYGLSGLGAMASPLVCQSVITTGAPWFHFYLGS
LVLSALNILLLAVAFKPNAAESVKERHLALSEARARAKVDCDARCDADPSKKASSSGCPASSFEPTNKHNTLKKA
LCIPLQWLFCAFALLYSGSETTTQGFMVTYLLATKHANPKTVGFVTSGFWAGLSVGRVCWGYFNGRLTFGQRKHI
VLFLISRATAFIGLFYGPVVPAALAIANDVLPSEVQMVAMALINAFASLGGAVFPIVTGTILNFRGVSAFPFITV
PLSASLIVFWGLFPSRVPTRNTGLA*
Coding >AgabiH97|011530
ATGGCCAGAGCTGAACCCGTGTTTTTGGACGATGTCGCCCTTGTCGACAGGCAGCAAAAAGATAGCTCCTCTGAT
ATATCTATCAAGGAATCAACACCTGCGCCGCCGCCGACCCCACAATCATTGACGCCTTTGCCTGGTGCACAAATA
CACGAGCGTGCCACCGTGATCGTTCCTTCTCCCTGCAACCCTGCTTTACCCATCCCTCGTATCCACGATCCTGTT
TCGCCATTGTCGGCAATTTCACTATCTACAGCACAAAGCCCTATCCTTGCATCCGGACAAGAAGAAGCGACTCAT
CTACAACATCGCTTCCGTACTTTGGGGTGGCGACTTGCCAGCGGTTATTTTGCCTGCTTCATTCTGAGCTGGGCC
GATGGAGTCACCGGTACTGTTTTACCCTATCTCAAGGCTGAGTTCAACCTTAGTACCATGACTTTATCCTTGTTA
TGGGGTGGTGGGACATGCGGATACTTCGCCGGGACTTTACTCGTCGAAAGCATCCTCAGGTGGCTGGGGCACTTC
AACTTTGATATCGAGCTGTCGAAAAGTGTTGACCATTCGTCTTTGGTTGCCTCGGACAAGAACACTCGAAACATC
GGTCATTCTGCTTCTCGTGCACGACACTTGACACTGCTCATGGGAAGTGTTTTACATGCAATCTTTTTCGCTATG
ATGGGATCGAAAAGCGGCTTCCCCGTCATGTTCGTAGCTTATGCTGTAGCTGCGTTTGCTCGTGCTGTGTTGAAT
GCCATCCTAAATTCCTATTTCGCCTCTGGTCCGAAGCAGGCACTCGGCTATGCCTATGGGCTTTCAGGCTTAGGT
GCTATGGCATCCCCTCTCGTTTGTCAATCCGTAATCACTACTGGCGCACCTTGGTTTCACTTCTATCTGGGTTCC
CTCGTTTTATCCGCTCTGAACATCTTACTCTTAGCGGTAGCTTTCAAGCCAAATGCGGCGGAGTCCGTCAAGGAG
CGCCACTTGGCTTTGAGCGAAGCGAGGGCGAGGGCGAAAGTTGATTGTGACGCCAGATGCGACGCTGATCCATCC
AAGAAGGCCTCCAGTTCCGGCTGCCCGGCTTCGAGTTTCGAGCCAACGAACAAGCATAACACTCTGAAGAAGGCA
CTCTGCATACCCCTTCAGTGGTTGTTCTGTGCATTTGCACTGCTTTACAGTGGGAGTGAAACAACCACCCAAGGC
TTCATGGTCACATATTTACTGGCAACCAAACACGCAAATCCAAAGACGGTTGGCTTTGTCACTTCGGGATTCTGG
GCAGGTCTCAGCGTCGGCCGTGTCTGTTGGGGATATTTCAACGGACGCCTCACATTCGGACAGAGGAAGCACATC
GTTCTTTTTCTCATTTCTCGGGCAACCGCGTTCATCGGACTCTTCTACGGACCCGTTGTTCCCGCGGCTCTGGCT
ATAGCAAACGATGTACTTCCCAGTGAAGTACAGATGGTTGCAATGGCGTTAATCAACGCGTTTGCTAGTCTCGGT
GGAGCTGTCTTTCCCATTGTTACAGGAACAATCCTGAACTTCAGAGGAGTCTCTGCGTTTCCTTTCATTACTGTT
CCCCTTTCAGCATCGTTGATCGTATTCTGGGGTCTATTCCCGTCCCGTGTTCCGACCAGAAACACTGGTCTGGCA
TGA
Transcript >AgabiH97|011530
ATGGCCAGAGCTGAACCCGTGTTTTTGGACGATGTCGCCCTTGTCGACAGGCAGCAAAAAGATAGCTCCTCTGAT
ATATCTATCAAGGAATCAACACCTGCGCCGCCGCCGACCCCACAATCATTGACGCCTTTGCCTGGTGCACAAATA
CACGAGCGTGCCACCGTGATCGTTCCTTCTCCCTGCAACCCTGCTTTACCCATCCCTCGTATCCACGATCCTGTT
TCGCCATTGTCGGCAATTTCACTATCTACAGCACAAAGCCCTATCCTTGCATCCGGACAAGAAGAAGCGACTCAT
CTACAACATCGCTTCCGTACTTTGGGGTGGCGACTTGCCAGCGGTTATTTTGCCTGCTTCATTCTGAGCTGGGCC
GATGGAGTCACCGGTACTGTTTTACCCTATCTCAAGGCTGAGTTCAACCTTAGTACCATGACTTTATCCTTGTTA
TGGGGTGGTGGGACATGCGGATACTTCGCCGGGACTTTACTCGTCGAAAGCATCCTCAGGTGGCTGGGGCACTTC
AACTTTGATATCGAGCTGTCGAAAAGTGTTGACCATTCGTCTTTGGTTGCCTCGGACAAGAACACTCGAAACATC
GGTCATTCTGCTTCTCGTGCACGACACTTGACACTGCTCATGGGAAGTGTTTTACATGCAATCTTTTTCGCTATG
ATGGGATCGAAAAGCGGCTTCCCCGTCATGTTCGTAGCTTATGCTGTAGCTGCGTTTGCTCGTGCTGTGTTGAAT
GCCATCCTAAATTCCTATTTCGCCTCTGGTCCGAAGCAGGCACTCGGCTATGCCTATGGGCTTTCAGGCTTAGGT
GCTATGGCATCCCCTCTCGTTTGTCAATCCGTAATCACTACTGGCGCACCTTGGTTTCACTTCTATCTGGGTTCC
CTCGTTTTATCCGCTCTGAACATCTTACTCTTAGCGGTAGCTTTCAAGCCAAATGCGGCGGAGTCCGTCAAGGAG
CGCCACTTGGCTTTGAGCGAAGCGAGGGCGAGGGCGAAAGTTGATTGTGACGCCAGATGCGACGCTGATCCATCC
AAGAAGGCCTCCAGTTCCGGCTGCCCGGCTTCGAGTTTCGAGCCAACGAACAAGCATAACACTCTGAAGAAGGCA
CTCTGCATACCCCTTCAGTGGTTGTTCTGTGCATTTGCACTGCTTTACAGTGGGAGTGAAACAACCACCCAAGGC
TTCATGGTCACATATTTACTGGCAACCAAACACGCAAATCCAAAGACGGTTGGCTTTGTCACTTCGGGATTCTGG
GCAGGTCTCAGCGTCGGCCGTGTCTGTTGGGGATATTTCAACGGACGCCTCACATTCGGACAGAGGAAGCACATC
GTTCTTTTTCTCATTTCTCGGGCAACCGCGTTCATCGGACTCTTCTACGGACCCGTTGTTCCCGCGGCTCTGGCT
ATAGCAAACGATGTACTTCCCAGTGAAGTACAGATGGTTGCAATGGCGTTAATCAACGCGTTTGCTAGTCTCGGT
GGAGCTGTCTTTCCCATTGTTACAGGAACAATCCTGAACTTCAGAGGAGTCTCTGCGTTTCCTTTCATTACTGTT
CCCCTTTCAGCATCGTTGATCGTATTCTGGGGTCTATTCCCGTCCCGTGTTCCGACCAGAAACACTGGTCTGGCA
TGA
Gene >AgabiH97|011530
ATGGCCAGAGCTGAACCCGTGTTTTTGGACGATGTCGCCCTTGTCGACAGGCAGCAAAAAGATAGCTCCTCTGAT
ATATCTATCAAGGAATCAACACCTGCGCCGCCGCCGACCCCACAATCATTGACGCCTTTGCCTGGTGCACAAATA
CACGAGCGTGCCACCGTGATCGTTCCTTCTCCCTGCAACCCTGCTTTACCCATCCCTCGTATCCACGATCCTGTT
TCGCCATTGTCGGCAATTTCACTATCTACAGCACAAAGCCCTATCCTTGCATCCGGACAAGAAGAAGCGACTCAT
CTACAACATCGCTTCCGTACTTTGGGGTGGCGACTTGCCAGCGGTTATTTTGCCTGCTTCATTCTGAGCTGGGCC
GATGGAGGTAGGTCATTATCCGTTCCTCCTCGCCGAAGGGAATGACGTCCCATTCAATGAATCAGTCACCGGTAC
TGTTTTACCCTGTGAGTGATCTTTGTGCTGTGACTATCCAAGGCCAGGCATTAATTGGACGTGATAGATCTCAAG
GCTGAGTTCAACCTTAGTACCATGACTTTATCCTTGTTATGGGGTGGTGGGACATGCGGGTGGGTATGCCAGCTC
TTCAATTTCAAGATGCTTCCTCATCACATTTTATCAGATACTTCGCCGGGACTTTACTCGTCGAAAGCATCCTCA
GGTGGCTGGGGCACTTCAACTTTGATATCGAGCTGTCGAAAAGTGTTGACCATTCGTCTTTGGTTGCCTCGGACA
AGAACACTCGAAACATCGGTCATTCTGCTTCTCGTGCACGACACTTGACACTGCTCATGGGAAGTGTTTTACATG
CAATCTTTTTCGCTATGATGGGATCGAAAAGCGGCTTCCCCGTCATGTTCGTAGCTTATGCTGTAGCTGCGTTTG
CTCGTGCTGTGTTGAATGGTAAGCTGTTTTCCTTAAACTACCCTTCCCATGGCTCCAAAAACTGCACTAATTGAG
ATGATTTCAGCCATCCTGTGAGCGGTATTTCCTCTTGAATCGCTAATGAGATTGGCTGAGAGTTGGTTGAGAAAT
TCCTATTTCGCCTCTGGTCCGAAGCAGGCACTCGGCTATGCCTATGGGCTTTCAGGTGAACATTTCTCCTGGTCT
GGGTTTCTAACCCGCTAAAGCAATGCAAACTCCAGGCTTAGGTGCTATGGCATCCCCTCTCGTTTGTCAATCCGT
AATCACTACTGGCGCACCTTGGTTTCACTTCTATCTGGGTTCCCTCGTTTTATCCGCTCTGAACATCTTACTCTT
AGCGGTAGCTTTCAAGCCAAATGCGGCGGAGTCCGTCAAGGAGCGCCACTTGGCTTTGAGCGAAGCGAGGGCGAG
GGCGAAAGTTGATTGTGACGCCAGATGCGACGCTGATCCATCCAAGAAGGCCTCCAGTTCCGGCTGCCCGGCTTC
GAGTTTCGAGCCAACGAACAAGCATAACAGTCAGTATCTGCTTTGATAGAGAGAGCAGAAGTTTTACAATAACCG
TCTGGCGCATCGCTTTGCGTCATTTTTCTTTTTCCCAGCTCTGAAGAAGGCACTCTGCATACCCCTTCAGTGGTT
GTTCTGTGCATTTGCACTGCTTTACAGTGGGAGGTGAGTTCCGGCTGAACGTAATTATGTGCCTGAATTCTCAGT
CAACGAACTTAGTGAAACAACCACCCAAGGCTTCGTACGTTTGATGCATACTCTCAAACAAGAATGAGGAAGAGC
GCTGACTTCAAATCAGATGGTCACATATTTACTGGCAACCAAAGTCAGTACCTGCAATCTCCTAGATGCATCCGA
TGCTAACACAATAGCTCTCTCTAGCACGCAAATCCAAAGACGGTTGGCTTTGTCACTTCGGGATTCTGGGCAGGT
CTCAGCGTCGGCCGTGTCTGTTGGGGATATTTCAACGGACGGTGAGTTCCGTGCGGTCCGTGTTTATAAAGCTCC
TGACTGTCTTCCAGCCTCACATTCGGACAGAGGAAGCACATCGTTCTTTTTCTCATGTAAGAGCGTCTCCACTTC
TTCAGGAACATCGTTCTAATAACAGCTTGTAGTTGTAAGCTTTGGAAGAATGACTTGATGATCGTCGTGCTCAAC
ATCGAACTGTAGTTCTCGGGGTGATCCTGGAAGTCCTCATCTGGGTCGTTCGCTCGCATGTACAAAATTCTATAG
CAACCGCGTTCATCGGACTCTTCTACGGACCCGTTGTTCCCGCGGCTCTGGCTATAGCAAACGATGTACTTCCCA
GTGAAGTACAGATGGTTGCAATGGCGTTAATGTAGGAACCATATCATCTGTCTCAGAGTAAAAGTCGGGTCTAAT
CCGTGTTGATGTTGTTTTCAGCAACGCGTTTGCTAGTCTCGGTGGAGGTGTGCTCGATCTTATGGGTTGCAACCC
CTGATCTAACCTGTATCCTTTAGCTGTCTTTCCCATTGTTACAGGAACAATCCTGAACTTCAGAGGAGTCTCTGC
GTTTCCTTTCATTACTGTTCCCCTTTCAGCATCGTTGATCGTATTCTGGGGTCTATTCCCGTCCCGTGTTCCGAC
CAGAAACACTGGTCTGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail