Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011350
Gene name
Locationscaffold_1:2685839..2686316
Strand-
Gene length (bp)477
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03226 Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly 1.7E-15 15 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR97|YIPL1_ARATH Protein yippee-like At3g08990 OS=Arabidopsis thaliana GN=At3g08990 PE=2 SV=2 14 103 5.0E-33
sp|P59234|YIPL_SOLTU Protein yippee-like OS=Solanum tuberosum PE=2 SV=1 1 103 4.0E-32
sp|Q9LY56|YIPL4_ARATH Protein yippee-like At3g55890 OS=Arabidopsis thaliana GN=At3g55890 PE=2 SV=1 1 102 6.0E-32
sp|Q9C777|YIPL3_ARATH Protein yippee-like At3g11230 OS=Arabidopsis thaliana GN=At3g11230 PE=2 SV=1 13 103 1.0E-31
sp|Q5XID5|YPEL4_RAT Protein yippee-like 4 OS=Rattus norvegicus GN=Ypel4 PE=1 SV=1 4 107 5.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR97|YIPL1_ARATH Protein yippee-like At3g08990 OS=Arabidopsis thaliana GN=At3g08990 PE=2 SV=2 14 103 5.0E-33
sp|P59234|YIPL_SOLTU Protein yippee-like OS=Solanum tuberosum PE=2 SV=1 1 103 4.0E-32
sp|Q9LY56|YIPL4_ARATH Protein yippee-like At3g55890 OS=Arabidopsis thaliana GN=At3g55890 PE=2 SV=1 1 102 6.0E-32
sp|Q9C777|YIPL3_ARATH Protein yippee-like At3g11230 OS=Arabidopsis thaliana GN=At3g11230 PE=2 SV=1 13 103 1.0E-31
sp|Q5XID5|YPEL4_RAT Protein yippee-like 4 OS=Rattus norvegicus GN=Ypel4 PE=1 SV=1 4 107 5.0E-31
sp|Q65Z93|YPEL4_MOUSE Protein yippee-like 4 OS=Mus musculus GN=Ypel4 PE=2 SV=1 4 107 5.0E-31
sp|Q96NS1|YPEL4_HUMAN Protein yippee-like 4 OS=Homo sapiens GN=YPEL4 PE=2 SV=1 4 107 7.0E-31
sp|Q65Z56|YPEL4_CHLAE Protein yippee-like 4 OS=Chlorocebus aethiops GN=YPEL4 PE=2 SV=1 4 107 7.0E-31
sp|P61237|YPEL3_MOUSE Protein yippee-like 3 OS=Mus musculus GN=Ypel3 PE=1 SV=1 13 107 1.0E-30
sp|A6QPH8|YPEL3_BOVIN Protein yippee-like 3 OS=Bos taurus GN=YPEL3 PE=3 SV=2 13 107 1.0E-30
sp|Q65Z57|YPEL3_CHLAE Protein yippee-like 3 OS=Chlorocebus aethiops GN=YPEL3 PE=3 SV=1 13 107 1.0E-30
sp|P61236|YPEL3_HUMAN Protein yippee-like 3 OS=Homo sapiens GN=YPEL3 PE=2 SV=1 13 107 1.0E-30
sp|Q9T096|YIPL6_ARATH Protein yippee-like At4g27745 OS=Arabidopsis thaliana GN=At4g27745 PE=3 SV=2 11 107 6.0E-30
sp|Q65Z54|YPEL3_ORYLA Protein yippee-like 3 OS=Oryzias latipes GN=ypel3 PE=3 SV=1 13 107 8.0E-30
sp|Q9U3G6|YPL1_CAEEL Protein yippee-like F37A8.5 OS=Caenorhabditis elegans GN=F37A8.5 PE=3 SV=1 4 107 9.0E-30
sp|Q2YDI3|YPEL2_BOVIN Protein yippee-like 2 OS=Bos taurus GN=YPEL2 PE=3 SV=1 13 102 9.0E-30
sp|Q65Z58|YPEL2_CHLAE Protein yippee-like 2 OS=Chlorocebus aethiops GN=YPEL2 PE=3 SV=1 13 102 9.0E-30
sp|Q65Z95|YPEL2_MOUSE Protein yippee-like 2 OS=Mus musculus GN=Ypel2 PE=2 SV=1 13 102 9.0E-30
sp|Q5RDN9|YPEL2_PONAB Protein yippee-like 2 OS=Pongo abelii GN=YPEL2 PE=3 SV=1 13 102 9.0E-30
sp|Q96QA6|YPEL2_HUMAN Protein yippee-like 2 OS=Homo sapiens GN=YPEL2 PE=1 SV=1 13 102 9.0E-30
sp|Q9ESC7|YPEL1_MOUSE Protein yippee-like 1 OS=Mus musculus GN=Ypel1 PE=2 SV=1 4 102 1.0E-29
sp|Q6NWI4|YPEL3_DANRE Protein yippee-like 3 OS=Danio rerio GN=ypel3 PE=3 SV=1 13 107 2.0E-29
sp|O60688|YPEL1_HUMAN Protein yippee-like 1 OS=Homo sapiens GN=YPEL1 PE=3 SV=1 13 102 2.0E-29
sp|Q9DG42|YPEL1_COTJA Protein yippee-like 1 OS=Coturnix coturnix japonica GN=YPEL1 PE=3 SV=1 13 102 2.0E-29
sp|Q65Z59|YPEL1_CHLAE Protein yippee-like 1 OS=Chlorocebus aethiops GN=YPEL1 PE=3 SV=1 13 102 2.0E-29
sp|Q9W2X7|YPL1_DROME Protein yippee-like CG15309 OS=Drosophila melanogaster GN=CG15309 PE=3 SV=1 1 102 3.0E-29
sp|Q9FN32|YIPL7_ARATH Protein yippee-like At5g53940 OS=Arabidopsis thaliana GN=At5g53940 PE=2 SV=1 1 108 2.0E-28
sp|Q5RDU7|YPEL5_PONAB Protein yippee-like 5 OS=Pongo abelii GN=YPEL5 PE=2 SV=1 1 106 1.0E-27
sp|Q3ZBE7|YPEL5_BOVIN Protein yippee-like 5 OS=Bos taurus GN=YPEL5 PE=2 SV=1 1 106 1.0E-27
sp|Q65Z55|YPEL5_CHLAE Protein yippee-like 5 OS=Chlorocebus aethiops GN=YPEL5 PE=2 SV=1 1 106 1.0E-27
sp|P62699|YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens GN=YPEL5 PE=1 SV=1 1 106 1.0E-27
sp|P62700|YPEL5_MOUSE Protein yippee-like 5 OS=Mus musculus GN=Ypel5 PE=1 SV=1 1 106 1.0E-27
sp|Q8S5M8|YIPL_ORYSJ Putative yippee-like protein Os10g0369500 OS=Oryza sativa subsp. japonica GN=Os10g0369500 PE=3 SV=1 14 103 1.0E-27
sp|Q4R4Q6|YPEL5_MACFA Protein yippee-like 5 OS=Macaca fascicularis GN=YPEL5 PE=2 SV=1 1 106 6.0E-27
sp|Q9XZF0|YIPP_DROME Protein yippee OS=Drosophila melanogaster GN=Yippee PE=1 SV=1 1 110 7.0E-27
sp|Q9URW3|YIPL_SCHPO Protein yippee-like PJ691.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ691.02 PE=3 SV=1 1 102 1.0E-25
sp|P38191|MOH1_YEAST Protein yippee-like MOH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOH1 PE=3 SV=1 15 102 1.0E-22
sp|O44440|YPL2_CAEEL Protein yippee-like B0546.4 OS=Caenorhabditis elegans GN=B0546.4 PE=3 SV=1 14 102 2.0E-21
sp|Q2V3E2|YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana GN=At4g27740 PE=3 SV=1 15 103 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011350
MGMSYRQYLYGDRIYGCSTCKTHLATIHSMMSRAFNGQHGRAYLFEGVVNVIEGEPNDRPMTTGNHTVRDIYCVK
CGTTLGWKYDKAYEPSQRYKEGKYILERNLLVDVQ*
Coding >AgabiH97|011350
ATGGGCATGAGTTATCGTCAGTATCTCTACGGCGACCGCATCTACGGCTGTTCAACATGCAAGACTCACCTCGCC
ACTATCCATTCCATGATGTCCAGGGCTTTCAACGGACAGCACGGCCGAGCCTATCTCTTTGAAGGAGTTGTAAAC
GTGATTGAAGGCGAACCCAACGACCGCCCCATGACTACTGGCAACCACACTGTCCGAGATATCTACTGCGTCAAA
TGTGGAACTACTCTGGGCTGGAAATATGACAAGGCCTATGAGCCTTCCCAACGATACAAAGAAGGCAAGTACATC
CTCGAGCGCAACTTGCTCGTAGATGTCCAGTAA
Transcript >AgabiH97|011350
ATGGGCATGAGTTATCGTCAGTATCTCTACGGCGACCGCATCTACGGCTGTTCAACATGCAAGACTCACCTCGCC
ACTATCCATTCCATGATGTCCAGGGCTTTCAACGGACAGCACGGCCGAGCCTATCTCTTTGAAGGAGTTGTAAAC
GTGATTGAAGGCGAACCCAACGACCGCCCCATGACTACTGGCAACCACACTGTCCGAGATATCTACTGCGTCAAA
TGTGGAACTACTCTGGGCTGGAAATATGACAAGGCCTATGAGCCTTCCCAACGATACAAAGAAGGCAAGTACATC
CTCGAGCGCAACTTGCTCGTAGATGTCCAGTAA
Gene >AgabiH97|011350
ATGGGCATGAGTTATCGTCAGTATCTCTACGGCGACCGCATCTACGGCTGTTCAACATGCAAGACTCACCTCGCC
ACTATCCATTCCATGATGTCCAGGGTACGCCACCACATCCCCAAATCACACCCCCCACACCCCACTCATCTCTCT
AGGCTTTCAACGGACAGCACGGCCGAGCCTATCTCTTTGAAGGAGTGCAAGTTCTTTCTTCTTCTCACCCTATCC
ATCTGACACCAACTAGTGTAAACGTGATTGAAGGCGAACCCAACGACCGCCCCATGACTACTGGCAACCACACTG
TCCGAGATATCTACTGCGTCAAATGTGGAACTACTCTGGGCTGGAAATATGTCAGTCGACCCACAGTATCTCCTA
TACTCATCTCATATCGCACAGGACAAGGCCTATGAGCCTTCCCAACGATACAAAGAAGGCAAGTACATCCTCGAG
CGCAACTTGCTCGTAGATGTCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail