Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011310
Gene name
Locationscaffold_1:2678400..2679133
Strand-
Gene length (bp)733
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 3.4E-24 36 129
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 1.1E-11 35 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 34 129 4.0E-32
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 35 129 3.0E-24
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 35 129 3.0E-24
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 36 129 1.0E-23
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 35 127 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 34 129 4.0E-32
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 35 129 3.0E-24
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 35 129 3.0E-24
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 36 129 1.0E-23
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 35 127 1.0E-23
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 31 129 2.0E-23
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 35 129 5.0E-23
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 34 129 6.0E-23
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 31 129 6.0E-23
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 31 129 7.0E-23
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 31 129 7.0E-23
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 31 129 7.0E-23
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 31 129 7.0E-23
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 35 129 1.0E-22
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 31 129 1.0E-22
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 31 129 1.0E-22
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 31 129 1.0E-22
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 31 129 1.0E-22
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 31 129 1.0E-22
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 31 129 1.0E-22
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 31 129 1.0E-22
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 31 129 1.0E-22
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 34 129 2.0E-22
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 31 129 2.0E-22
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 31 129 2.0E-22
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 31 129 2.0E-22
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 31 129 2.0E-22
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 31 129 2.0E-22
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 31 129 5.0E-22
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 31 129 1.0E-20
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 35 129 1.0E-20
sp|P01113|RASH_MSVMO GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 31 129 2.0E-20
sp|P23175|RASH_MSVNS GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 31 129 4.0E-20
sp|P15064|RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum GN=rasG PE=1 SV=1 31 129 5.0E-20
sp|P01114|RASH_RRASV Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 28 129 5.0E-20
sp|P34726|RAS2_PHYPO Ras-like protein 2 OS=Physarum polycephalum GN=RAS-2 PE=2 SV=1 46 129 8.0E-20
sp|P34729|RAS1_PHYPO Ras-like protein 1 OS=Physarum polycephalum GN=RAS1 PE=2 SV=1 31 129 8.0E-20
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 31 129 1.0E-19
sp|P01115|RASH_MSVHA Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 28 129 1.0E-19
sp|P03967|RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum GN=rasD PE=2 SV=2 31 129 1.0E-19
sp|P01120|RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 26 129 4.0E-19
sp|P28775|RAS_LENED Ras-like protein OS=Lentinula edodes PE=3 SV=1 46 129 7.0E-19
sp|P22278|RAS1_MUCCL Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 46 129 7.0E-19
sp|P0CQ42|RAS_CRYNJ Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 46 129 8.0E-19
sp|P0CQ43|RAS_CRYNB Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 46 129 8.0E-19
sp|P22280|RAS3_MUCCL Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 46 129 8.0E-19
sp|P01119|RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 46 129 1.0E-18
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 42 129 1.0E-18
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 23 129 2.0E-18
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 23 129 2.0E-18
sp|Q05058|RASL_COPCI 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 46 129 4.0E-18
sp|A8NU18|RASL_COPC7 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 46 129 4.0E-18
sp|O93856|RAS_LACBI Ras-like protein OS=Laccaria bicolor PE=2 SV=1 46 129 5.0E-18
sp|Q12526|RAS_EMENI Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rasA PE=2 SV=2 46 129 8.0E-18
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 23 129 1.0E-17
sp|O42785|RASL_COLTR Ras-like protein OS=Colletotrichum trifolii GN=RAS PE=2 SV=1 46 129 1.0E-17
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 35 129 2.0E-17
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 35 129 2.0E-17
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 35 129 2.0E-17
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 35 129 2.0E-17
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 35 129 2.0E-17
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 35 129 2.0E-17
sp|P51539|RAS1_HYDVU Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 46 129 3.0E-17
sp|P62071|RRAS2_MOUSE Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 29 129 3.0E-17
sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 29 129 3.0E-17
sp|P87018|RAS_BOTFU Ras-like protein OS=Botryotinia fuckeliana GN=ras1 PE=3 SV=1 46 129 3.0E-17
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 29 129 4.0E-17
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 29 129 4.0E-17
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 29 129 4.0E-17
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 29 129 4.0E-17
sp|Q99578|RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 34 123 5.0E-17
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 34 127 5.0E-17
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 31 129 5.0E-17
sp|P38976|RAS2_HYDVU Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 30 129 5.0E-17
sp|P22981|LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans GN=let-60 PE=1 SV=1 46 129 6.0E-17
sp|P70426|RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 34 129 8.0E-17
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 34 129 9.0E-17
sp|Q5BJQ5|RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 34 123 2.0E-16
sp|P70425|RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 34 123 2.0E-16
sp|P32252|RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum GN=rasB PE=1 SV=1 46 129 2.0E-16
sp|B4KB60|RAS1_DROMO Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|B4PUP5|RAS1_DROYA Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|P83831|RAS1_DROSI Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|B4HKC7|RAS1_DROSE Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|P08646|RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 46 129 2.0E-16
sp|P83832|RAS1_DROMA Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|B3NZR4|RAS1_DROER Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|B3M185|RAS1_DROAN Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 46 129 2.0E-16
sp|B4JFU8|RAS1_DROGR Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 46 129 3.0E-16
sp|B4LY29|RAS1_DROVI Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 46 129 3.0E-16
sp|B4NJ72|RAS1_DROWI Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 46 129 3.0E-16
sp|C4YKT4|RAS1_CANAW Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 46 129 3.0E-16
sp|P0CY32|RAS1_CANAX Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 46 129 3.0E-16
sp|Q59XU5|RAS1_CANAL Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 46 129 3.0E-16
sp|Q295X7|RAS1_DROPS Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 46 129 3.0E-16
sp|B4GFJ8|RAS1_DROPE Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 46 129 3.0E-16
sp|P79800|RASK_MELGA GTPase KRas OS=Meleagris gallopavo GN=KRAS PE=2 SV=1 46 129 1.0E-15
sp|P08647|RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 46 129 1.0E-15
sp|O14807|RASM_HUMAN Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2 29 129 1.0E-15
sp|Q07983|RASK_MONDO GTPase KRas OS=Monodelphis domestica GN=KRAS PE=1 SV=1 46 129 2.0E-15
sp|P97538|RASM_RAT Ras-related protein M-Ras OS=Rattus norvegicus GN=Mras PE=1 SV=2 29 129 2.0E-15
sp|Q9YH38|RASK_CYPCA GTPase KRas OS=Cyprinus carpio GN=kras PE=2 SV=1 46 129 2.0E-15
sp|P08642|RASH_CHICK GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 46 129 2.0E-15
sp|Q5EFX7|RASK_KRYMA GTPase KRas OS=Kryptolebias marmoratus GN=kras PE=2 SV=1 46 129 2.0E-15
sp|P20171|RASH_RAT GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 46 129 2.0E-15
sp|Q61411|RASH_MOUSE GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 46 129 2.0E-15
sp|P01112|RASH_HUMAN GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 46 129 2.0E-15
sp|O42277|RASK_ORYLA GTPase KRas OS=Oryzias latipes GN=kras1 PE=2 SV=1 46 129 2.0E-15
sp|P05774|RAS_CARAU Ras-like protein (Fragment) OS=Carassius auratus PE=3 SV=1 31 129 3.0E-15
sp|P01116|RASK_HUMAN GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1 31 129 3.0E-15
sp|O08989|RASM_MOUSE Ras-related protein M-Ras OS=Mus musculus GN=Mras PE=1 SV=1 29 129 3.0E-15
sp|P08644|RASK_RAT GTPase KRas OS=Rattus norvegicus GN=Kras PE=1 SV=3 31 129 3.0E-15
sp|P32883|RASK_MOUSE GTPase KRas OS=Mus musculus GN=Kras PE=1 SV=1 31 129 3.0E-15
sp|Q05147|RASK_XENLA GTPase KRas OS=Xenopus laevis GN=kras PE=2 SV=1 46 129 4.0E-15
sp|Q55BW0|RAPC_DICDI Ras-related protein rapC OS=Dictyostelium discoideum GN=rapC PE=3 SV=1 31 123 5.0E-15
sp|P22126|RAS1_NEUCR Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 46 129 6.0E-15
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 34 126 6.0E-15
sp|Q86L51|RAPB_DICDI Ras-related protein rapB OS=Dictyostelium discoideum GN=rapB PE=3 SV=1 33 129 9.0E-15
sp|Q60529|RASH_MESAU GTPase HRas (Fragment) OS=Mesocricetus auratus GN=HRAS PE=3 SV=1 31 123 1.0E-14
sp|Q5R6S2|DIRA2_PONAB GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 34 127 2.0E-14
sp|Q95KD9|DIRA2_MACFA GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 34 127 3.0E-14
sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 34 127 3.0E-14
sp|Q5PR73|DIRA2_MOUSE GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 34 127 3.0E-14
sp|Q91806|RASN_XENLA GTPase NRas OS=Xenopus laevis GN=nras PE=2 SV=1 46 129 3.0E-14
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 35 127 4.0E-14
sp|P12825|RASN_CAVPO GTPase NRas OS=Cavia porcellus GN=NRAS PE=2 SV=1 46 129 5.0E-14
sp|P08556|RASN_MOUSE GTPase NRas OS=Mus musculus GN=Nras PE=1 SV=1 46 129 5.0E-14
sp|Q5F352|RASN_CHICK GTPase NRas OS=Gallus gallus GN=NRAS PE=2 SV=1 46 129 5.0E-14
sp|Q91079|RAS_LIMLI Ras-like protein (Fragment) OS=Limanda limanda GN=ras PE=3 SV=1 46 123 5.0E-14
sp|Q2MJK3|RASN_PIG GTPase NRas OS=Sus scrofa GN=NRAS PE=2 SV=1 46 129 6.0E-14
sp|Q95ME4|RASN_MONDO GTPase NRas OS=Monodelphis domestica GN=NRAS PE=2 SV=1 46 129 6.0E-14
sp|P01111|RASN_HUMAN GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1 46 129 6.0E-14
sp|Q04970|RASN_RAT GTPase NRas OS=Rattus norvegicus GN=Nras PE=1 SV=1 46 129 6.0E-14
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 35 127 7.0E-14
sp|P79737|RASN_DANRE GTPase NRas OS=Danio rerio GN=nras PE=2 SV=1 46 129 1.0E-13
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 34 127 3.0E-13
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 34 127 3.0E-13
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 34 127 3.0E-13
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 34 127 3.0E-13
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 35 127 3.0E-13
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 35 127 3.0E-13
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 35 127 3.0E-13
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 35 127 3.0E-13
sp|Q5RD87|RASN_PONAB GTPase NRas OS=Pongo abelii GN=NRAS PE=2 SV=1 46 129 3.0E-13
sp|Q5R988|RAP2A_PONAB Ras-related protein Rap-2a OS=Pongo abelii GN=RAP2A PE=2 SV=2 46 129 3.0E-13
sp|Q80ZJ1|RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus GN=Rap2a PE=1 SV=2 46 129 3.0E-13
sp|P61227|RAP2B_RAT Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 46 129 3.0E-13
sp|P61226|RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 46 129 3.0E-13
sp|P61225|RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 46 129 3.0E-13
sp|Q06AU2|RAP2A_PIG Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 46 129 3.0E-13
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 35 127 3.0E-13
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 35 127 4.0E-13
sp|P10114|RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1 46 129 4.0E-13
sp|P04388|RAS2_DROME Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 30 129 8.0E-13
sp|Q8BU31|RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus GN=Rap2c PE=1 SV=1 46 129 8.0E-13
sp|Q9Y3L5|RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1 46 129 8.0E-13
sp|Q08DI5|RAP2C_BOVIN Ras-related protein Rap-2c OS=Bos taurus GN=RAP2C PE=2 SV=1 46 129 8.0E-13
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 34 122 1.0E-12
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 34 127 1.0E-12
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 34 127 1.0E-12
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 34 127 1.0E-12
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 34 127 3.0E-12
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 34 127 4.0E-12
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 34 120 4.0E-12
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 34 127 5.0E-12
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 35 127 5.0E-12
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 34 127 6.0E-12
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 34 127 6.0E-12
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 34 127 7.0E-12
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 34 127 7.0E-12
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 34 127 7.0E-12
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 34 127 7.0E-12
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 34 127 7.0E-12
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 35 127 7.0E-12
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 34 127 7.0E-12
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 34 127 7.0E-12
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 34 127 8.0E-12
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 34 127 8.0E-12
sp|P52498|RSR1_CANAX Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 46 129 9.0E-12
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 34 127 9.0E-12
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 34 127 9.0E-12
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 34 127 9.0E-12
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 35 128 1.0E-11
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 34 127 1.0E-11
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 34 127 1.0E-11
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 34 127 1.0E-11
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 34 127 1.0E-11
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 34 127 1.0E-11
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 34 127 1.0E-11
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 34 127 1.0E-11
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 34 127 1.0E-11
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 34 127 1.0E-11
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 34 127 1.0E-11
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 34 127 1.0E-11
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 35 128 1.0E-11
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 35 128 1.0E-11
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 34 127 1.0E-11
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 34 129 1.0E-11
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 34 127 2.0E-11
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 35 126 2.0E-11
sp|P34443|RHEB1_CAEEL GTP-binding protein Rheb homolog 1 OS=Caenorhabditis elegans GN=rheb-1 PE=3 SV=1 35 130 2.0E-11
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 34 127 2.0E-11
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 40 127 2.0E-11
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 35 129 2.0E-11
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 18 127 2.0E-11
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 35 128 2.0E-11
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 29 127 2.0E-11
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 35 128 2.0E-11
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 28 129 3.0E-11
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 21 129 4.0E-11
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 34 129 4.0E-11
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 34 127 4.0E-11
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 7 129 4.0E-11
sp|P10301|RRAS_HUMAN Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 46 129 5.0E-11
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 34 127 5.0E-11
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 21 129 5.0E-11
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 21 129 5.0E-11
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 21 129 5.0E-11
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 21 129 5.0E-11
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 21 129 5.0E-11
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 33 127 5.0E-11
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 29 129 5.0E-11
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 29 129 5.0E-11
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 34 127 5.0E-11
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 21 129 5.0E-11
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 34 127 5.0E-11
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 34 127 5.0E-11
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 34 127 5.0E-11
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 29 129 5.0E-11
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 29 129 5.0E-11
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 34 127 5.0E-11
sp|P10833|RRAS_MOUSE Ras-related protein R-Ras OS=Mus musculus GN=Rras PE=1 SV=1 46 129 6.0E-11
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 34 127 6.0E-11
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 29 129 6.0E-11
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 34 127 6.0E-11
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 34 127 7.0E-11
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 34 127 7.0E-11
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 34 127 7.0E-11
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 34 128 7.0E-11
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 34 129 7.0E-11
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 34 127 8.0E-11
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 34 129 8.0E-11
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 34 128 9.0E-11
sp|Q0VCJ7|RERG_BOVIN Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 35 130 9.0E-11
sp|Q96A58|RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 35 130 1.0E-10
sp|D3Z8L7|RRAS_RAT Ras-related protein R-Ras OS=Rattus norvegicus GN=Rras PE=1 SV=1 46 129 1.0E-10
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 33 127 1.0E-10
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 1 127 1.0E-10
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 18 129 1.0E-10
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 34 129 1.0E-10
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 34 127 1.0E-10
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 33 127 1.0E-10
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 33 127 1.0E-10
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 29 129 1.0E-10
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 34 129 1.0E-10
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 34 127 1.0E-10
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 34 127 1.0E-10
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 33 127 1.0E-10
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 34 129 1.0E-10
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 34 127 1.0E-10
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 33 127 1.0E-10
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 34 127 2.0E-10
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 34 127 2.0E-10
sp|Q8R367|RERG_MOUSE Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 35 130 2.0E-10
sp|Q54BW4|CPAS2_DICDI Circularly permutated Ras protein 2 OS=Dictyostelium discoideum GN=cpras2 PE=3 SV=1 79 129 2.0E-10
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 34 124 2.0E-10
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 31 118 2.0E-10
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 31 118 2.0E-10
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 31 118 2.0E-10
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 34 128 2.0E-10
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 34 129 2.0E-10
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 34 124 2.0E-10
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 35 128 2.0E-10
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 34 128 2.0E-10
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 34 128 2.0E-10
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 27 129 2.0E-10
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 35 127 2.0E-10
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 34 129 2.0E-10
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 34 128 2.0E-10
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 34 127 2.0E-10
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 35 129 2.0E-10
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 19 129 2.0E-10
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 34 129 3.0E-10
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 34 129 3.0E-10
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 34 129 3.0E-10
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 34 129 3.0E-10
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 34 127 3.0E-10
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 34 127 3.0E-10
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 34 127 3.0E-10
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 34 127 3.0E-10
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 35 129 3.0E-10
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 35 129 3.0E-10
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 18 127 3.0E-10
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 35 128 3.0E-10
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 34 129 3.0E-10
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 34 127 3.0E-10
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 35 127 3.0E-10
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 35 127 3.0E-10
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 35 122 3.0E-10
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 34 127 3.0E-10
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 35 127 3.0E-10
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 34 129 3.0E-10
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 34 127 3.0E-10
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 35 127 3.0E-10
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 34 129 3.0E-10
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 34 129 3.0E-10
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 19 129 3.0E-10
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 19 129 3.0E-10
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 19 129 3.0E-10
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 35 128 3.0E-10
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 34 127 3.0E-10
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 35 122 3.0E-10
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 35 128 3.0E-10
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 34 127 3.0E-10
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 34 127 3.0E-10
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 35 128 4.0E-10
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 35 128 4.0E-10
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 35 128 4.0E-10
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 35 128 4.0E-10
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 34 129 4.0E-10
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 34 124 4.0E-10
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 35 128 4.0E-10
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 34 129 4.0E-10
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 34 129 4.0E-10
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 34 127 4.0E-10
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 34 129 5.0E-10
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 35 129 5.0E-10
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 28 129 5.0E-10
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 34 129 5.0E-10
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 34 127 6.0E-10
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 34 127 6.0E-10
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 35 127 6.0E-10
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 34 129 6.0E-10
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 34 129 6.0E-10
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 34 124 7.0E-10
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 34 127 7.0E-10
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 34 127 7.0E-10
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 33 129 7.0E-10
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 34 124 7.0E-10
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 34 127 7.0E-10
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 34 129 8.0E-10
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 34 124 8.0E-10
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 35 127 8.0E-10
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 34 124 8.0E-10
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 34 124 8.0E-10
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 34 124 8.0E-10
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 34 124 8.0E-10
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 34 124 8.0E-10
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 34 127 9.0E-10
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 34 127 9.0E-10
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 34 124 9.0E-10
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 35 127 9.0E-10
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 34 127 1.0E-09
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 34 127 1.0E-09
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 34 127 1.0E-09
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 35 123 1.0E-09
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 34 129 1.0E-09
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 35 128 2.0E-09
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 31 118 2.0E-09
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 34 124 2.0E-09
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 35 128 2.0E-09
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 34 130 2.0E-09
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 35 127 2.0E-09
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 34 124 2.0E-09
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 35 128 2.0E-09
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 34 124 2.0E-09
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 34 127 2.0E-09
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 34 124 2.0E-09
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 34 129 2.0E-09
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 34 127 2.0E-09
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 35 127 3.0E-09
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 35 127 3.0E-09
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 35 127 3.0E-09
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 34 129 3.0E-09
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 34 124 3.0E-09
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 34 129 3.0E-09
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 3 127 3.0E-09
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 34 124 3.0E-09
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 31 118 3.0E-09
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 35 123 3.0E-09
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 34 127 4.0E-09
sp|Q9GPS3|RACF2_DICDI Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 31 118 4.0E-09
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 34 127 4.0E-09
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 34 127 4.0E-09
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 34 127 4.0E-09
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 34 129 4.0E-09
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 19 127 5.0E-09
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 35 128 5.0E-09
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 34 130 5.0E-09
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 34 127 5.0E-09
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 34 127 5.0E-09
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 34 127 5.0E-09
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 34 127 5.0E-09
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 34 127 5.0E-09
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 34 129 6.0E-09
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 28 117 6.0E-09
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 31 118 6.0E-09
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 31 118 6.0E-09
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 31 118 6.0E-09
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 31 118 6.0E-09
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 31 118 6.0E-09
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 31 118 6.0E-09
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 35 120 6.0E-09
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 34 127 6.0E-09
sp|Q7TN89|RASE_MOUSE GTPase ERas OS=Mus musculus GN=Eras PE=1 SV=1 30 123 6.0E-09
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 34 129 6.0E-09
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 34 129 7.0E-09
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 34 124 7.0E-09
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 34 124 7.0E-09
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 31 117 8.0E-09
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 31 118 8.0E-09
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 31 118 8.0E-09
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 40 122 8.0E-09
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 35 120 8.0E-09
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 35 118 8.0E-09
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 35 128 8.0E-09
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 35 127 8.0E-09
sp|Q9JKF8|RASD1_RAT Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus GN=Rasd1 PE=1 SV=1 21 128 9.0E-09
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 35 127 9.0E-09
sp|Q9Y272|RASD1_HUMAN Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1 21 128 9.0E-09
sp|Q56JV3|RHEB_BOVIN GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 35 118 9.0E-09
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 28 117 9.0E-09
sp|O35626|RASD1_MOUSE Dexamethasone-induced Ras-related protein 1 OS=Mus musculus GN=Rasd1 PE=1 SV=1 21 128 1.0E-08
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 31 118 1.0E-08
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 31 122 1.0E-08
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 31 118 1.0E-08
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 34 127 1.0E-08
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 34 129 1.0E-08
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 31 118 1.0E-08
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 35 129 1.0E-08
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 34 129 1.0E-08
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 31 118 1.0E-08
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 35 127 1.0E-08
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 27 127 1.0E-08
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 34 127 1.0E-08
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 34 130 1.0E-08
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 31 118 1.0E-08
sp|Q75J93|CPAS1_DICDI Circularly permutated Ras protein 1 OS=Dictyostelium discoideum GN=cpras1 PE=3 SV=1 79 129 1.0E-08
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 35 122 1.0E-08
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 35 128 1.0E-08
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 12 127 1.0E-08
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 35 128 2.0E-08
sp|O94103|CDC42_COLGL Cell division control protein 42 homolog OS=Colletotrichum gloeosporioides GN=CDC42 PE=3 SV=1 35 118 2.0E-08
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 31 118 2.0E-08
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 35 128 2.0E-08
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 35 122 2.0E-08
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 34 130 2.0E-08
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 27 129 2.0E-08
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 34 130 2.0E-08
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 34 127 2.0E-08
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 35 120 2.0E-08
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 35 130 2.0E-08
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 34 129 2.0E-08
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 35 118 2.0E-08
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 31 120 2.0E-08
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 31 118 2.0E-08
sp|Q9VND8|RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 35 128 2.0E-08
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 34 117 2.0E-08
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 34 127 3.0E-08
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 34 129 3.0E-08
sp|O96390|RACF1_DICDI Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 31 118 3.0E-08
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 35 120 3.0E-08
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 35 122 3.0E-08
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 35 129 3.0E-08
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 31 118 3.0E-08
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 35 118 3.0E-08
sp|Q7Z444|RASE_HUMAN GTPase ERas OS=Homo sapiens GN=ERAS PE=2 SV=1 30 123 3.0E-08
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 34 127 4.0E-08
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 34 127 4.0E-08
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 35 127 4.0E-08
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 12 127 4.0E-08
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 12 127 4.0E-08
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 35 118 4.0E-08
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 34 127 4.0E-08
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 34 127 4.0E-08
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 34 127 4.0E-08
sp|P28748|SPI1_SCHPO GTP-binding nuclear protein spi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spi1 PE=1 SV=1 30 129 4.0E-08
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 35 118 4.0E-08
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 35 122 4.0E-08
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 35 118 4.0E-08
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 35 127 4.0E-08
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 31 118 4.0E-08
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 35 129 4.0E-08
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 35 122 4.0E-08
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 35 118 5.0E-08
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 35 128 5.0E-08
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 34 127 5.0E-08
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 35 118 5.0E-08
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 35 128 5.0E-08
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 28 129 5.0E-08
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 31 118 5.0E-08
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 35 118 6.0E-08
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 35 118 6.0E-08
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 34 127 6.0E-08
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 12 127 6.0E-08
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 12 127 6.0E-08
sp|Q8TFK3|GSP1_YARLI GTP-binding nuclear protein GSP1/Ran OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GSP1 PE=3 SV=1 34 129 6.0E-08
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 34 127 7.0E-08
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 35 118 7.0E-08
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 31 118 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011310
MSRSYNNNTVNSNNNAVLANPHNENININNMDRWRVAVLGDGGVGKTALAVQFTLNCFVEVIHQQYKLKQLVVDN
RMCFVEVIDTAGQEEYATLRNQWVREGQAFILVYSIASRVTFERLENFLRQVLRA*
Coding >AgabiH97|011310
ATGTCGCGTTCCTACAATAACAACACCGTCAATTCCAACAACAATGCTGTCCTCGCCAATCCTCACAACGAGAAT
ATCAATATCAACAATATGGACCGCTGGAGGGTCGCCGTCCTAGGTGACGGTGGTGTAGGCAAGACTGCTCTCGCT
GTGCAGTTCACTCTGAATTGTTTCGTTGAGGTAATACATCAACAATATAAGCTAAAACAGCTGGTAGTCGATAAC
CGCATGTGCTTTGTTGAAGTCATCGACACGGCCGGCCAAGAGGAATACGCTACGCTTCGGAATCAGTGGGTTCGA
GAGGGTCAGGCTTTCATCCTGGTTTATTCGATCGCATCGCGGGTGACCTTTGAGCGGTTGGAAAACTTCCTGCGA
CAAGTCCTACGAGCGTGA
Transcript >AgabiH97|011310
ATGTCGCGTTCCTACAATAACAACACCGTCAATTCCAACAACAATGCTGTCCTCGCCAATCCTCACAACGAGAAT
ATCAATATCAACAATATGGACCGCTGGAGGGTCGCCGTCCTAGGTGACGGTGGTGTAGGCAAGACTGCTCTCGCT
GTGCAGTTCACTCTGAATTGTTTCGTTGAGGTAATACATCAACAATATAAGCTAAAACAGCTGGTAGTCGATAAC
CGCATGTGCTTTGTTGAAGTCATCGACACGGCCGGCCAAGAGGAATACGCTACGCTTCGGAATCAGTGGGTTCGA
GAGGGTCAGGCTTTCATCCTGGTTTATTCGATCGCATCGCGGGTGACCTTTGAGCGGTTGGAAAACTTCCTGCGA
CAAGTCCTACGAGCGTGA
Gene >AgabiH97|011310
ATGTCGCGTTCCTACAATAACAACACCGTCAATTCCAACAACAATGCTGTCCTCGCCAATCCTCACAACGAGAAT
ATCAATATCAACAATATGGACCGCTGGAGGGTCGCCGTCCTAGGTGACGGTGGTGTAGGCAAGACTGCTCTCGCT
GTGCAGGTGAGCCGACTTGCTCCCTCCTCTCTGCCTAATTCGCTTACCCCCGCCTCAGTTCACTCTGAATTGTTT
CGTTGGTATGTCAAGCCACTTTGTTTGTCTGAGCAAGTCTTAATTGTCTGTTTGCCCCTTTTTCCGCTGTTTAGA
GGTAATACATCAACAATATAAGCTGTGCTTAGCTAACCTATAAAATAAGACTTACGATCCAACAATTGAAGACGC
GTATAGAAAACAGCTGGTAGTCGATAACCGCATGTGCTTTGTTGAAGTCATCGACACGGCCGGCCAAGGTATCTG
TCTCGAGCTATGTTTGCTCTCTACGAAACTTATCTTCATACACAGAGGAATACGCTACGCTTCGGAATCAGTGGG
TTCGGTAAGTACTTCTATGCCTCGCATCAATCATACCAGCTGAAAACAATTCTAGAGAGGGTCAGGCTTTCATCC
TGGTTTATTCGATCGCATCGCGGGTGACCTTTGAGCGGTTGGAAAACTTCCGTCAGTCGATGCGCCGTGTCAAAC
GCGGTGATACAATCTTCATGCTTGTCGGTAACAAGTGCGACAAGTCCTACGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail