Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011170
Gene name
Locationscaffold_1:2636470..2648251
Strand-
Gene length (bp)11781
Transcript length (bp)8133
Coding sequence length (bp)8133
Protein length (aa) 2711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16507 BLM10_mid Proteasome-substrate-size regulator, mid region 3.3E-190 1149 1683
PF11919 DUF3437 Domain of unknown function (DUF3437) 1.0E-29 2623 2710
PF06968 BATS Biotin and Thiamin Synthesis associated domain 1.4E-19 251 342
PF04055 Radical_SAM Radical SAM superfamily 2.4E-16 79 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59778|BIOB_SCHPO Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bio2 PE=1 SV=1 13 358 2.0E-142
sp|P54967|BIOB_ARATH Biotin synthase OS=Arabidopsis thaliana GN=BIO2 PE=2 SV=1 33 341 8.0E-130
sp|P32451|BIOB_YEAST Biotin synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO2 PE=1 SV=2 34 348 9.0E-128
sp|Q11S94|BIOB_CYTH3 Biotin synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=bioB PE=3 SV=1 33 360 3.0E-121
sp|B2J914|BIOB_NOSP7 Biotin synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=bioB PE=3 SV=1 33 344 8.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59778|BIOB_SCHPO Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bio2 PE=1 SV=1 13 358 2.0E-142
sp|P54967|BIOB_ARATH Biotin synthase OS=Arabidopsis thaliana GN=BIO2 PE=2 SV=1 33 341 8.0E-130
sp|P32451|BIOB_YEAST Biotin synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO2 PE=1 SV=2 34 348 9.0E-128
sp|Q11S94|BIOB_CYTH3 Biotin synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=bioB PE=3 SV=1 33 360 3.0E-121
sp|B2J914|BIOB_NOSP7 Biotin synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=bioB PE=3 SV=1 33 344 8.0E-117
sp|Q93GG2|BIOB_ACICA Biotin synthase OS=Acinetobacter calcoaceticus GN=bioB PE=3 SV=1 33 341 1.0E-111
sp|B0VCA8|BIOB_ACIBY Biotin synthase OS=Acinetobacter baumannii (strain AYE) GN=bioB PE=3 SV=2 33 341 4.0E-111
sp|A3M4U4|BIOB_ACIBT Biotin synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=bioB PE=3 SV=2 33 341 4.0E-111
sp|B2HYX9|BIOB_ACIBC Biotin synthase OS=Acinetobacter baumannii (strain ACICU) GN=bioB PE=3 SV=1 33 341 4.0E-111
sp|B7I4I4|BIOB_ACIB5 Biotin synthase OS=Acinetobacter baumannii (strain AB0057) GN=bioB PE=3 SV=1 33 341 4.0E-111
sp|B7H3S4|BIOB_ACIB3 Biotin synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=bioB PE=3 SV=1 33 341 4.0E-111
sp|A0M7A9|BIOB_GRAFK Biotin synthase OS=Gramella forsetii (strain KT0803) GN=bioB PE=3 SV=1 33 365 6.0E-111
sp|B0VR41|BIOB_ACIBS Biotin synthase OS=Acinetobacter baumannii (strain SDF) GN=bioB PE=3 SV=2 33 341 1.0E-110
sp|Q31E55|BIOB_THICR Biotin synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=bioB PE=3 SV=1 33 359 4.0E-110
sp|Q8YVQ3|BIOB_NOSS1 Biotin synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bioB PE=3 SV=1 33 342 4.0E-110
sp|Q6FAP9|BIOB_ACIAD Biotin synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=bioB PE=3 SV=2 33 341 4.0E-110
sp|Q3M4U9|BIOB_ANAVT Biotin synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=bioB PE=3 SV=1 33 342 2.0E-109
sp|Q12D73|BIOB2_POLSJ Biotin synthase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioB2 PE=3 SV=2 36 342 7.0E-109
sp|Q3J9D5|BIOB_NITOC Biotin synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=bioB PE=3 SV=1 33 353 1.0E-108
sp|A1VUJ4|BIOB_POLNA Biotin synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bioB PE=3 SV=1 34 366 2.0E-108
sp|Q3IGS6|BIOB_PSEHT Biotin synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=bioB PE=3 SV=1 33 366 7.0E-108
sp|A8AJ12|BIOB_CITK8 Biotin synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=bioB PE=3 SV=1 36 359 1.0E-107
sp|Q2NB65|BIOB_ERYLH Biotin synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=bioB PE=3 SV=1 33 361 2.0E-107
sp|A3N520|BIOB_BURP6 Biotin synthase OS=Burkholderia pseudomallei (strain 668) GN=bioB PE=3 SV=2 16 353 2.0E-107
sp|A1V817|BIOB_BURMS Biotin synthase OS=Burkholderia mallei (strain SAVP1) GN=bioB PE=3 SV=1 16 353 2.0E-107
sp|Q62MW9|BIOB_BURMA Biotin synthase OS=Burkholderia mallei (strain ATCC 23344) GN=bioB PE=3 SV=2 16 353 2.0E-107
sp|A2S7R3|BIOB_BURM9 Biotin synthase OS=Burkholderia mallei (strain NCTC 10229) GN=bioB PE=3 SV=2 16 353 2.0E-107
sp|A3MNG1|BIOB_BURM7 Biotin synthase OS=Burkholderia mallei (strain NCTC 10247) GN=bioB PE=3 SV=2 16 353 2.0E-107
sp|A0KIC6|BIOB_AERHH Biotin synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioB PE=3 SV=1 29 365 3.0E-107
sp|Q138Z3|BIOB_RHOPS Biotin synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=bioB PE=3 SV=1 33 341 4.0E-107
sp|Q7MLV0|BIOB_VIBVY Biotin synthase OS=Vibrio vulnificus (strain YJ016) GN=bioB PE=3 SV=2 33 341 5.0E-107
sp|Q8D8M9|BIOB_VIBVU Biotin synthase OS=Vibrio vulnificus (strain CMCP6) GN=bioB PE=3 SV=2 33 341 5.0E-107
sp|Q87QN6|BIOB_VIBPA Biotin synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=bioB PE=3 SV=1 33 362 5.0E-107
sp|A7FKM9|BIOB_YERP3 Biotin synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=bioB PE=3 SV=1 32 341 6.0E-107
sp|A5FLT1|BIOB_FLAJ1 Biotin synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=bioB PE=3 SV=1 32 347 7.0E-107
sp|Q0TJS3|BIOB_ECOL5 Biotin synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=bioB PE=3 SV=1 33 341 7.0E-107
sp|A1U4B2|BIOB_MARHV Biotin synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=bioB PE=3 SV=1 28 341 7.0E-107
sp|B5YRL4|BIOB_ECO5E Biotin synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=bioB PE=3 SV=1 33 341 8.0E-107
sp|Q8X825|BIOB_ECO57 Biotin synthase OS=Escherichia coli O157:H7 GN=bioB PE=3 SV=3 33 341 8.0E-107
sp|A7MX36|BIOB_VIBCB Biotin synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=bioB PE=3 SV=2 33 341 8.0E-107
sp|B1JSS4|BIOB_YERPY Biotin synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|Q66D67|BIOB_YERPS Biotin synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|A4TNQ6|BIOB_YERPP Biotin synthase OS=Yersinia pestis (strain Pestoides F) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|Q1CFQ3|BIOB_YERPN Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|A9R3C8|BIOB_YERPG Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|Q7CH65|BIOB_YERPE Biotin synthase OS=Yersinia pestis GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|B2K8T0|BIOB_YERPB Biotin synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|Q1C947|BIOB_YERPA Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=bioB PE=3 SV=1 32 341 9.0E-107
sp|Q63Y25|BIOB_BURPS Biotin synthase OS=Burkholderia pseudomallei (strain K96243) GN=bioB PE=3 SV=2 16 341 9.0E-107
sp|A3NQS1|BIOB_BURP0 Biotin synthase OS=Burkholderia pseudomallei (strain 1106a) GN=bioB PE=3 SV=1 16 341 9.0E-107
sp|A9EXH2|BIOB_SORC5 Biotin synthase OS=Sorangium cellulosum (strain So ce56) GN=bioB PE=3 SV=2 29 344 1.0E-106
sp|Q3Z409|BIOB_SHISS Biotin synthase OS=Shigella sonnei (strain Ss046) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B1LM66|BIOB_ECOSM Biotin synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7NA74|BIOB_ECOLU Biotin synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|P12996|BIOB_ECOLI Biotin synthase OS=Escherichia coli (strain K12) GN=bioB PE=1 SV=2 33 341 1.0E-106
sp|B1IXJ3|BIOB_ECOLC Biotin synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|A7ZY31|BIOB_ECOHS Biotin synthase OS=Escherichia coli O9:H4 (strain HS) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B1X7A5|BIOB_ECODH Biotin synthase OS=Escherichia coli (strain K12 / DH10B) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7M747|BIOB_ECO8A Biotin synthase OS=Escherichia coli O8 (strain IAI1) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7NNK5|BIOB_ECO7I Biotin synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7LC57|BIOB_ECO55 Biotin synthase OS=Escherichia coli (strain 55989 / EAEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7ULX2|BIOB_ECO27 Biotin synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|A7ZJI4|BIOB_ECO24 Biotin synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|A6X2S8|BIOB_OCHA4 Biotin synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=bioB PE=3 SV=1 28 341 1.0E-106
sp|B6I7S9|BIOB_ECOSE Biotin synthase OS=Escherichia coli (strain SE11) GN=bioB PE=3 SV=1 33 341 1.0E-106
sp|B7LJY8|BIOB_ESCF3 Biotin synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=bioB PE=3 SV=1 36 341 1.0E-106
sp|A9MJE6|BIOB_SALAR Biotin synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=bioB PE=3 SV=1 31 341 2.0E-106
sp|Q2T1Q4|BIOB_BURTA Biotin synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=bioB PE=3 SV=2 36 351 2.0E-106
sp|A1JS69|BIOB_YERE8 Biotin synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioB PE=3 SV=1 36 341 3.0E-106
sp|Q15SR5|BIOB_PSEA6 Biotin synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=bioB PE=3 SV=1 17 355 3.0E-106
sp|B1Y502|BIOB_LEPCP Biotin synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=bioB PE=3 SV=1 40 365 3.0E-106
sp|Q0VMD0|BIOB_ALCBS Biotin synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=bioB PE=3 SV=1 18 365 4.0E-106
sp|Q324B7|BIOB_SHIBS Biotin synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=bioB PE=3 SV=1 33 341 4.0E-106
sp|B2TVF5|BIOB_SHIB3 Biotin synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=bioB PE=3 SV=1 33 341 4.0E-106
sp|Q1REF5|BIOB_ECOUT Biotin synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=bioB PE=3 SV=1 33 341 5.0E-106
sp|Q8FJQ3|BIOB_ECOL6 Biotin synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bioB PE=3 SV=1 33 341 5.0E-106
sp|A1A917|BIOB_ECOK1 Biotin synthase OS=Escherichia coli O1:K1 / APEC GN=bioB PE=3 SV=1 33 341 5.0E-106
sp|B7MQM8|BIOB_ECO81 Biotin synthase OS=Escherichia coli O81 (strain ED1a) GN=bioB PE=3 SV=1 33 341 5.0E-106
sp|B7MGN3|BIOB_ECO45 Biotin synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=bioB PE=3 SV=1 33 341 5.0E-106
sp|Q3JWR8|BIOB_BURP1 Biotin synthase OS=Burkholderia pseudomallei (strain 1710b) GN=bioB PE=3 SV=2 16 341 5.0E-106
sp|P12678|BIOB_SALTY Biotin synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioB PE=3 SV=2 31 341 5.0E-106
sp|C0PWY2|BIOB_SALPC Biotin synthase OS=Salmonella paratyphi C (strain RKS4594) GN=bioB PE=3 SV=1 31 341 5.0E-106
sp|A9MTI8|BIOB_SALPB Biotin synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=bioB PE=3 SV=1 31 341 5.0E-106
sp|B4SZJ7|BIOB_SALNS Biotin synthase OS=Salmonella newport (strain SL254) GN=bioB PE=3 SV=1 31 341 5.0E-106
sp|A6T6L5|BIOB_KLEP7 Biotin synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=bioB PE=3 SV=2 36 341 5.0E-106
sp|A7MJ03|BIOB_CROS8 Biotin synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=bioB PE=3 SV=1 28 341 5.0E-106
sp|Q57RG3|BIOB_SALCH Biotin synthase OS=Salmonella choleraesuis (strain SC-B67) GN=bioB PE=3 SV=1 31 341 5.0E-106
sp|Q83S46|BIOB_SHIFL Biotin synthase OS=Shigella flexneri GN=bioB PE=3 SV=1 33 341 6.0E-106
sp|Q0T6I5|BIOB_SHIF8 Biotin synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=bioB PE=3 SV=1 33 341 6.0E-106
sp|Q32I44|BIOB_SHIDS Biotin synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=bioB PE=3 SV=1 33 341 6.0E-106
sp|Q9KSZ4|BIOB_VIBCH Biotin synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=bioB PE=3 SV=1 32 341 7.0E-106
sp|A5F2H3|BIOB_VIBC3 Biotin synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=bioB PE=3 SV=1 32 341 7.0E-106
sp|Q47862|BIOB_ESCVU Biotin synthase OS=Escherichia vulneris GN=bioB PE=3 SV=1 36 341 8.0E-106
sp|B4TQT9|BIOB_SALSV Biotin synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|B5BC31|BIOB_SALPK Biotin synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|Q5PG48|BIOB_SALPA Biotin synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|B4TC48|BIOB_SALHS Biotin synthase OS=Salmonella heidelberg (strain SL476) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|B5QX65|BIOB_SALEP Biotin synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|B5FP61|BIOB_SALDC Biotin synthase OS=Salmonella dublin (strain CT_02021853) GN=bioB PE=3 SV=1 31 341 8.0E-106
sp|Q8Z893|BIOB_SALTI Biotin synthase OS=Salmonella typhi GN=bioB PE=3 SV=1 31 341 1.0E-105
sp|B5F072|BIOB_SALA4 Biotin synthase OS=Salmonella agona (strain SL483) GN=bioB PE=3 SV=1 31 341 1.0E-105
sp|A4SPR7|BIOB_AERS4 Biotin synthase OS=Aeromonas salmonicida (strain A449) GN=bioB PE=3 SV=1 33 341 1.0E-105
sp|Q0ATN3|BIOB_MARMM Biotin synthase OS=Maricaulis maris (strain MCS10) GN=bioB PE=3 SV=1 33 352 2.0E-105
sp|B5EUQ0|BIOB_VIBFM Biotin synthase OS=Vibrio fischeri (strain MJ11) GN=bioB PE=3 SV=1 32 341 2.0E-105
sp|B5XZ75|BIOB_KLEP3 Biotin synthase OS=Klebsiella pneumoniae (strain 342) GN=bioB PE=3 SV=1 33 341 2.0E-105
sp|A5CWW0|BIOB_VESOH Biotin synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=bioB PE=3 SV=1 33 341 3.0E-105
sp|Q8Y2R9|BIOB_RALSO Biotin synthase OS=Ralstonia solanacearum (strain GMI1000) GN=bioB PE=3 SV=1 36 341 3.0E-105
sp|Q2GAF7|BIOB_NOVAD Biotin synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=bioB PE=3 SV=1 33 371 3.0E-105
sp|B2JKH4|BIOB_BURP8 Biotin synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=bioB PE=3 SV=1 36 341 3.0E-105
sp|A1AWE7|BIOB_RUTMC Biotin synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=bioB PE=3 SV=1 33 341 4.0E-105
sp|P36569|BIOB_SERMA Biotin synthase OS=Serratia marcescens GN=bioB PE=3 SV=2 33 341 4.0E-105
sp|B5R761|BIOB_SALG2 Biotin synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=bioB PE=3 SV=1 31 341 5.0E-105
sp|Q6D3B9|BIOB_PECAS Biotin synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=bioB PE=3 SV=1 33 341 6.0E-105
sp|B1WN69|BIOB_VIBF1 Biotin synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=bioB PE=3 SV=1 32 341 6.0E-105
sp|B2UDA1|BIOB_RALPJ Biotin synthase OS=Ralstonia pickettii (strain 12J) GN=bioB PE=3 SV=1 36 341 1.0E-104
sp|B2IEZ6|BIOB_BEII9 Biotin synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=bioB PE=3 SV=1 28 336 1.0E-104
sp|A6GW77|BIOB_FLAPJ Biotin synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=bioB PE=3 SV=1 31 351 2.0E-104
sp|B7VH16|BIOB_VIBTL Biotin synthase OS=Vibrio tasmaniensis (strain LGP32) GN=bioB PE=3 SV=1 33 341 2.0E-104
sp|Q2IUT3|BIOB_RHOP2 Biotin synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=bioB PE=3 SV=1 33 341 2.0E-104
sp|A9CFX5|BIOB_AGRFC Biotin synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=bioB PE=3 SV=1 39 344 2.0E-104
sp|B8GTH4|BIOB_THISH Biotin synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=bioB PE=3 SV=1 33 351 3.0E-104
sp|B1KPJ7|BIOB_SHEWM Biotin synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=bioB PE=3 SV=1 33 341 3.0E-104
sp|B4ESU3|BIOB_PROMH Biotin synthase OS=Proteus mirabilis (strain HI4320) GN=bioB PE=3 SV=1 32 341 4.0E-104
sp|A7HP26|BIOB_PARL1 Biotin synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=bioB PE=3 SV=2 33 344 5.0E-104
sp|Q7N6Q7|BIOB_PHOLL Biotin synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=bioB PE=3 SV=1 31 341 7.0E-104
sp|A4W8B7|BIOB_ENT38 Biotin synthase OS=Enterobacter sp. (strain 638) GN=bioB PE=3 SV=1 36 341 8.0E-104
sp|Q1GTT5|BIOB_SPHAL Biotin synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=bioB PE=3 SV=1 33 348 9.0E-104
sp|B6ESC7|BIOB_ALISL Biotin synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=bioB PE=3 SV=1 32 341 1.0E-103
sp|Q146K5|BIOB_BURXL Biotin synthase OS=Burkholderia xenovorans (strain LB400) GN=bioB PE=3 SV=1 36 341 2.0E-103
sp|Q7NDA8|BIOB_GLOVI Biotin synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=bioB PE=3 SV=1 40 342 2.0E-103
sp|A4VR88|BIOB_PSEU5 Biotin synthase OS=Pseudomonas stutzeri (strain A1501) GN=bioB PE=3 SV=1 29 342 2.0E-103
sp|A8GBC5|BIOB_SERP5 Biotin synthase OS=Serratia proteamaculans (strain 568) GN=bioB PE=3 SV=1 33 341 2.0E-103
sp|A4XZR9|BIOB_PSEMY Biotin synthase OS=Pseudomonas mendocina (strain ymp) GN=bioB PE=3 SV=1 25 342 3.0E-103
sp|Q609V2|BIOB_METCA Biotin synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioB PE=3 SV=2 31 341 3.0E-103
sp|Q212A8|BIOB_RHOPB Biotin synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=bioB PE=3 SV=1 33 342 3.0E-103
sp|Q8PDF0|BIOB_XANCP Biotin synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=bioB PE=3 SV=1 31 344 3.0E-103
sp|B0RMR2|BIOB_XANCB Biotin synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=bioB PE=3 SV=1 31 344 3.0E-103
sp|Q4UZN8|BIOB_XANC8 Biotin synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=bioB PE=3 SV=1 31 344 3.0E-103
sp|Q88QX2|BIOB_PSEPK Biotin synthase OS=Pseudomonas putida (strain KT2440) GN=bioB PE=3 SV=1 32 342 4.0E-103
sp|Q1DCV9|BIOB_MYXXD Biotin synthase OS=Myxococcus xanthus (strain DK 1622) GN=bioB PE=3 SV=1 9 341 4.0E-103
sp|B2SWS5|BIOB_BURPP Biotin synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=bioB PE=3 SV=1 36 341 4.0E-103
sp|A6W0Y1|BIOB_MARMS Biotin synthase OS=Marinomonas sp. (strain MWYL1) GN=bioB PE=3 SV=2 33 341 4.0E-103
sp|Q47IF6|BIOB_DECAR Biotin synthase OS=Dechloromonas aromatica (strain RCB) GN=bioB PE=3 SV=1 36 344 6.0E-103
sp|B3QCX3|BIOB_RHOPT Biotin synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=bioB PE=3 SV=1 33 341 7.0E-103
sp|Q6N859|BIOB_RHOPA Biotin synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=bioB PE=3 SV=1 33 341 7.0E-103
sp|Q2W3L4|BIOB_MAGSA Biotin synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=bioB PE=3 SV=1 33 344 8.0E-103
sp|A5VUG1|BIOB_BRUO2 Biotin synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|Q8FWG3|BIOB_BRUSU Biotin synthase OS=Brucella suis biovar 1 (strain 1330) GN=bioB PE=3 SV=1 24 342 1.0E-102
sp|A9WYH2|BIOB_BRUSI Biotin synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|Q8YBW1|BIOB_BRUME Biotin synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|C0RL26|BIOB_BRUMB Biotin synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|A9MBD6|BIOB_BRUC2 Biotin synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|Q577P8|BIOB_BRUAB Biotin synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|Q2YKB8|BIOB_BRUA2 Biotin synthase OS=Brucella abortus (strain 2308) GN=bioB PE=3 SV=1 24 342 1.0E-102
sp|B2SBF0|BIOB_BRUA1 Biotin synthase OS=Brucella abortus (strain S19) GN=bioB PE=3 SV=2 24 342 1.0E-102
sp|A1S5I9|BIOB_SHEAM Biotin synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=bioB PE=3 SV=1 33 342 1.0E-102
sp|Q9A2N5|BIOB_CAUCR Biotin synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=bioB PE=3 SV=1 33 346 1.0E-102
sp|B8H640|BIOB_CAUCN Biotin synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=bioB PE=3 SV=1 33 346 1.0E-102
sp|Q2KWF1|BIOB_BORA1 Biotin synthase OS=Bordetella avium (strain 197N) GN=bioB PE=3 SV=1 32 341 2.0E-102
sp|Q83CU5|BIOB_COXBU Biotin synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bioB PE=3 SV=1 34 342 2.0E-102
sp|A9NCS0|BIOB_COXBR Biotin synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=bioB PE=3 SV=1 34 342 2.0E-102
sp|A9KG71|BIOB_COXBN Biotin synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=bioB PE=3 SV=1 34 342 2.0E-102
sp|B6J074|BIOB_COXB2 Biotin synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=bioB PE=3 SV=1 34 342 2.0E-102
sp|B6J725|BIOB_COXB1 Biotin synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=bioB PE=3 SV=1 34 342 2.0E-102
sp|A5VXF1|BIOB_PSEP1 Biotin synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=bioB PE=3 SV=1 32 342 3.0E-102
sp|Q4K4T2|BIOB_PSEF5 Biotin synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=bioB PE=3 SV=2 33 360 3.0E-102
sp|Q5P7M6|BIOB_AROAE Biotin synthase OS=Aromatoleum aromaticum (strain EbN1) GN=bioB PE=3 SV=2 33 341 5.0E-102
sp|A1K9C8|BIOB_AZOSB Biotin synthase OS=Azoarcus sp. (strain BH72) GN=bioB PE=3 SV=1 33 341 6.0E-102
sp|B4SM81|BIOB_STRM5 Biotin synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=bioB PE=3 SV=1 28 345 7.0E-102
sp|B0KJ53|BIOB_PSEPG Biotin synthase OS=Pseudomonas putida (strain GB-1) GN=bioB PE=3 SV=1 32 342 8.0E-102
sp|B1JE55|BIOB_PSEPW Biotin synthase OS=Pseudomonas putida (strain W619) GN=bioB PE=3 SV=1 32 342 8.0E-102
sp|Q07PI4|BIOB_RHOP5 Biotin synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=bioB PE=3 SV=1 33 341 1.0E-101
sp|Q48CS1|BIOB_PSE14 Biotin synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=bioB PE=3 SV=1 33 342 1.0E-101
sp|Q4ZMA8|BIOB_PSEU2 Biotin synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=bioB PE=3 SV=1 33 342 1.0E-101
sp|B4S0P9|BIOB_ALTMD Biotin synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=bioB PE=3 SV=1 33 356 1.0E-101
sp|Q1I3N6|BIOB_PSEE4 Biotin synthase OS=Pseudomonas entomophila (strain L48) GN=bioB PE=3 SV=1 32 342 1.0E-101
sp|Q1LS73|BIOB_CUPMC Biotin synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=bioB PE=3 SV=2 36 338 2.0E-101
sp|Q0C661|BIOB_HYPNA Biotin synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=bioB PE=3 SV=1 33 336 2.0E-101
sp|Q2NUJ7|BIOB_SODGM Biotin synthase OS=Sodalis glossinidius (strain morsitans) GN=bioB PE=3 SV=1 32 341 2.0E-101
sp|Q9I618|BIOB_PSEAE Biotin synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bioB PE=3 SV=1 32 342 2.0E-101
sp|B7V485|BIOB_PSEA8 Biotin synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=bioB PE=3 SV=1 32 342 2.0E-101
sp|Q8EDK6|BIOB_SHEON Biotin synthase OS=Shewanella oneidensis (strain MR-1) GN=bioB PE=3 SV=1 32 341 2.0E-101
sp|B2FLM4|BIOB_STRMK Biotin synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=bioB PE=3 SV=1 28 366 3.0E-101
sp|A8FX10|BIOB_SHESH Biotin synthase OS=Shewanella sediminis (strain HAW-EB3) GN=bioB PE=3 SV=1 33 341 5.0E-101
sp|B3PI87|BIOB_CELJU Biotin synthase OS=Cellvibrio japonicus (strain Ueda107) GN=bioB PE=3 SV=2 24 342 5.0E-101
sp|B4E9L4|BIOB_BURCJ Biotin synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=bioB PE=3 SV=1 34 341 6.0E-101
sp|Q88A98|BIOB_PSESM Biotin synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=bioB PE=3 SV=1 33 342 7.0E-101
sp|A4G1F1|BIOB_HERAR Biotin synthase OS=Herminiimonas arsenicoxydans GN=bioB PE=3 SV=1 28 346 7.0E-101
sp|Q477A1|BIOB_CUPPJ Biotin synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=bioB PE=3 SV=1 19 338 7.0E-101
sp|Q87F85|BIOB_XYLFT Biotin synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=bioB PE=3 SV=1 28 365 7.0E-101
sp|B2I672|BIOB_XYLF2 Biotin synthase OS=Xylella fastidiosa (strain M23) GN=bioB PE=3 SV=1 28 365 7.0E-101
sp|A1RIK5|BIOB_SHESW Biotin synthase OS=Shewanella sp. (strain W3-18-1) GN=bioB PE=3 SV=1 33 359 8.0E-101
sp|A4Y7Y3|BIOB_SHEPC Biotin synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=bioB PE=3 SV=1 33 359 8.0E-101
sp|Q9PH80|BIOB_XYLFA Biotin synthase OS=Xylella fastidiosa (strain 9a5c) GN=bioB PE=3 SV=1 28 365 9.0E-101
sp|Q255G8|BIOB_CHLFF Biotin synthase OS=Chlamydophila felis (strain Fe/C-56) GN=bioB PE=3 SV=1 32 347 1.0E-100
sp|A6SU66|BIOB_JANMA Biotin synthase OS=Janthinobacterium sp. (strain Marseille) GN=bioB PE=3 SV=1 28 346 1.0E-100
sp|Q5N332|BIOB_SYNP6 Biotin synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=bioB PE=3 SV=1 33 344 1.0E-100
sp|Q31R68|BIOB_SYNE7 Biotin synthase OS=Synechococcus elongatus (strain PCC 7942) GN=bioB PE=3 SV=1 33 344 1.0E-100
sp|B0U2A0|BIOB_XYLFM Biotin synthase OS=Xylella fastidiosa (strain M12) GN=bioB PE=3 SV=1 28 365 1.0E-100
sp|Q0KF86|BIOB_CUPNH Biotin synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bioB PE=3 SV=1 36 338 1.0E-100
sp|Q02TR6|BIOB_PSEAB Biotin synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=bioB PE=3 SV=1 32 342 1.0E-100
sp|A6UYW0|BIOB_PSEA7 Biotin synthase OS=Pseudomonas aeruginosa (strain PA7) GN=bioB PE=3 SV=1 25 342 2.0E-100
sp|Q8PQD7|BIOB_XANAC Biotin synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bioB PE=3 SV=1 31 344 2.0E-100
sp|A0KB05|BIOB_BURCH Biotin synthase OS=Burkholderia cenocepacia (strain HI2424) GN=bioB PE=3 SV=1 34 341 2.0E-100
sp|B1JZE1|BIOB_BURCC Biotin synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=bioB PE=3 SV=1 34 341 2.0E-100
sp|Q1BT34|BIOB_BURCA Biotin synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=bioB PE=3 SV=1 34 341 2.0E-100
sp|B2VBT9|BIOB_ERWT9 Biotin synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=bioB PE=3 SV=1 36 341 2.0E-100
sp|A1SW31|BIOB_PSYIN Biotin synthase OS=Psychromonas ingrahamii (strain 37) GN=bioB PE=3 SV=1 33 341 3.0E-100
sp|Q6LPR2|BIOB_PHOPR Biotin synthase OS=Photobacterium profundum GN=bioB PE=3 SV=1 33 351 3.0E-100
sp|Q5QZ16|BIOB_IDILO Biotin synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=bioB PE=3 SV=1 33 342 3.0E-100
sp|B5ELR8|BIOB_ACIF5 Biotin synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=bioB PE=3 SV=1 41 341 3.0E-100
sp|B7J403|BIOB_ACIF2 Biotin synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=bioB PE=3 SV=1 41 341 3.0E-100
sp|B8F6C9|BIOB_HAEPS Biotin synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=bioB PE=3 SV=1 16 345 4.0E-100
sp|Q2SBD4|BIOB_HAHCH Biotin synthase OS=Hahella chejuensis (strain KCTC 2396) GN=bioB PE=3 SV=1 33 341 4.0E-100
sp|A9KY60|BIOB_SHEB9 Biotin synthase OS=Shewanella baltica (strain OS195) GN=bioB PE=3 SV=1 33 358 4.0E-100
sp|A6WM55|BIOB_SHEB8 Biotin synthase OS=Shewanella baltica (strain OS185) GN=bioB PE=3 SV=1 33 358 4.0E-100
sp|A3D3F2|BIOB_SHEB5 Biotin synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=bioB PE=3 SV=1 33 358 4.0E-100
sp|B8EAJ2|BIOB_SHEB2 Biotin synthase OS=Shewanella baltica (strain OS223) GN=bioB PE=3 SV=1 33 358 4.0E-100
sp|B1YNS2|BIOB_BURA4 Biotin synthase OS=Burkholderia ambifaria (strain MC40-6) GN=bioB PE=3 SV=1 28 341 4.0E-100
sp|Q8D2A1|BIOB_WIGBR Biotin synthase OS=Wigglesworthia glossinidia brevipalpis GN=bioB PE=3 SV=2 36 342 4.0E-100
sp|B2AGA0|BIOB_CUPTR Biotin synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=bioB PE=3 SV=1 35 338 4.0E-100
sp|Q21FY3|BIOB_SACD2 Biotin synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioB PE=3 SV=1 31 341 5.0E-100
sp|A4JIB7|BIOB_BURVG Biotin synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=bioB PE=3 SV=1 28 341 6.0E-100
sp|Q3BYM9|BIOB_XANC5 Biotin synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=bioB PE=3 SV=1 31 344 6.0E-100
sp|Q0HTY9|BIOB_SHESR Biotin synthase OS=Shewanella sp. (strain MR-7) GN=bioB PE=3 SV=1 33 341 6.0E-100
sp|Q0HHN7|BIOB_SHESM Biotin synthase OS=Shewanella sp. (strain MR-4) GN=bioB PE=3 SV=1 33 341 6.0E-100
sp|A0KY79|BIOB_SHESA Biotin synthase OS=Shewanella sp. (strain ANA-3) GN=bioB PE=3 SV=1 33 341 6.0E-100
sp|Q2JRI4|BIOB_SYNJA Biotin synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=bioB PE=3 SV=1 41 342 7.0E-100
sp|Q0BBD4|BIOB_BURCM Biotin synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=bioB PE=3 SV=1 28 341 8.0E-100
sp|B9JYY6|BIOB_AGRVS Biotin synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=bioB PE=3 SV=1 25 340 9.0E-100
sp|A1B656|BIOB2_PARDP Biotin synthase 2 OS=Paracoccus denitrificans (strain Pd 1222) GN=bioB2 PE=3 SV=1 43 341 1.0E-99
sp|Q39CE4|BIOB_BURL3 Biotin synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=bioB PE=3 SV=1 28 341 1.0E-99
sp|Q2GHB1|BIOB_EHRCR Biotin synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=bioB PE=3 SV=1 33 342 2.0E-99
sp|B0U811|BIOB_METS4 Biotin synthase OS=Methylobacterium sp. (strain 4-46) GN=bioB PE=3 SV=1 33 341 2.0E-99
sp|A8H3I7|BIOB_SHEPA Biotin synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=bioB PE=3 SV=1 33 356 2.0E-99
sp|B0TJN8|BIOB_SHEHH Biotin synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=bioB PE=3 SV=1 33 353 2.0E-99
sp|Q5NRD6|BIOB_ZYMMO Biotin synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=bioB PE=3 SV=2 32 341 2.0E-99
sp|A9AE44|BIOB_BURM1 Biotin synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=bioB PE=3 SV=1 28 341 2.0E-99
sp|Q3K5P1|BIOB_PSEPF Biotin synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=bioB PE=3 SV=1 33 360 2.0E-99
sp|Q5H5R1|BIOB_XANOR Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=bioB PE=3 SV=2 31 344 3.0E-99
sp|B2SS67|BIOB_XANOP Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=bioB PE=3 SV=1 31 344 3.0E-99
sp|Q2P8F3|BIOB_XANOM Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=bioB PE=3 SV=1 31 344 3.0E-99
sp|A3QDN8|BIOB_SHELP Biotin synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=bioB PE=3 SV=1 33 341 6.0E-99
sp|B8IU36|BIOB_METNO Biotin synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=bioB PE=3 SV=1 22 336 6.0E-99
sp|Q3YRG6|BIOB_EHRCJ Biotin synthase OS=Ehrlichia canis (strain Jake) GN=bioB PE=3 SV=1 32 340 7.0E-99
sp|B0T1Y4|BIOB_CAUSK Biotin synthase OS=Caulobacter sp. (strain K31) GN=bioB PE=3 SV=1 33 335 1.0E-98
sp|Q5WW97|BIOB_LEGPL Biotin synthase OS=Legionella pneumophila (strain Lens) GN=bioB PE=3 SV=1 33 344 1.0E-98
sp|A5VAC6|BIOB_SPHWW Biotin synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=bioB PE=3 SV=1 33 346 1.0E-98
sp|Q5ZVG8|BIOB_LEGPH Biotin synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioB PE=3 SV=1 33 344 1.0E-98
sp|Q5X592|BIOB_LEGPA Biotin synthase OS=Legionella pneumophila (strain Paris) GN=bioB PE=3 SV=1 33 344 1.0E-98
sp|B8CQY2|BIOB_SHEPW Biotin synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=bioB PE=3 SV=1 33 356 2.0E-98
sp|A5FZN9|BIOB_ACICJ Biotin synthase OS=Acidiphilium cryptum (strain JF-5) GN=bioB PE=3 SV=1 54 345 2.0E-98
sp|A5IBW2|BIOB_LEGPC Biotin synthase OS=Legionella pneumophila (strain Corby) GN=bioB PE=3 SV=1 36 345 2.0E-98
sp|Q481G0|BIOB_COLP3 Biotin synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=bioB PE=3 SV=2 31 341 2.0E-98
sp|Q5LN74|BIOB_RUEPO Biotin synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=bioB PE=3 SV=1 28 340 5.0E-98
sp|Q3SW30|BIOB_NITWN Biotin synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=bioB PE=3 SV=1 24 341 7.0E-98
sp|Q5FFY2|BIOB_EHRRG Biotin synthase OS=Ehrlichia ruminantium (strain Gardel) GN=bioB PE=3 SV=1 33 342 7.0E-98
sp|Q5HAN0|BIOB_EHRRW Biotin synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=bioB PE=3 SV=1 33 342 8.0E-98
sp|Q8K9P1|BIOB_BUCAP Biotin synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bioB PE=3 SV=1 33 341 1.0E-97
sp|Q0A5W1|BIOB_ALKEH Biotin synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=bioB PE=3 SV=2 33 361 1.0E-97
sp|A8G5G3|BIOB_PROM2 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=bioB PE=3 SV=1 24 348 2.0E-97
sp|B4RBP5|BIOB_PHEZH Biotin synthase OS=Phenylobacterium zucineum (strain HLK1) GN=bioB PE=3 SV=1 33 345 2.0E-97
sp|Q1QYD5|BIOB_CHRSD Biotin synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=bioB PE=3 SV=1 33 365 2.0E-97
sp|B9J9I5|BIOB_AGRRK Biotin synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=bioB PE=3 SV=2 33 340 2.0E-97
sp|Q1GZA6|BIOB_METFK Biotin synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=bioB PE=3 SV=1 36 341 3.0E-97
sp|A7IEC3|BIOB_XANP2 Biotin synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=bioB PE=3 SV=1 29 341 4.0E-97
sp|A9C2R2|BIOB_DELAS Biotin synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=bioB PE=3 SV=1 36 349 5.0E-97
sp|Q7NPW1|BIOB_CHRVO Biotin synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=bioB PE=3 SV=1 33 342 5.0E-97
sp|B6JDD7|BIOB_OLICO Biotin synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=bioB PE=3 SV=1 33 341 6.0E-97
sp|Q1QRH1|BIOB_NITHX Biotin synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=bioB PE=3 SV=1 23 341 7.0E-97
sp|Q084I8|BIOB_SHEFN Biotin synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=bioB PE=3 SV=1 33 341 9.0E-97
sp|A5EFG5|BIOB_BRASB Biotin synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=bioB PE=3 SV=1 33 341 9.0E-97
sp|Q31AD2|BIOB_PROM9 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=bioB PE=3 SV=1 24 348 1.0E-96
sp|Q0BUV5|BIOB_GRABC Biotin synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=bioB PE=3 SV=2 31 341 1.0E-96
sp|Q82SL7|BIOB_NITEU Biotin synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=bioB PE=3 SV=2 21 344 2.0E-96
sp|A2BRS2|BIOB_PROMS Biotin synthase OS=Prochlorococcus marinus (strain AS9601) GN=bioB PE=3 SV=1 24 348 2.0E-96
sp|B1LV19|BIOB_METRJ Biotin synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=bioB PE=3 SV=1 33 324 2.0E-96
sp|A3PDJ8|BIOB_PROM0 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=bioB PE=3 SV=2 24 348 3.0E-96
sp|A5WHI6|BIOB_PSYWF Biotin synthase OS=Psychrobacter sp. (strain PRwf-1) GN=bioB PE=3 SV=1 38 341 3.0E-96
sp|Q2Y9Y9|BIOB_NITMU Biotin synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioB PE=3 SV=1 36 341 3.0E-96
sp|Q0AE72|BIOB_NITEC Biotin synthase OS=Nitrosomonas eutropha (strain C91) GN=bioB PE=3 SV=1 28 344 4.0E-96
sp|Q9Z6L5|BIOB_CHLPN Biotin synthase OS=Chlamydia pneumoniae GN=bioB PE=3 SV=1 35 347 7.0E-96
sp|A5GLZ1|BIOB_SYNPW Biotin synthase OS=Synechococcus sp. (strain WH7803) GN=bioB PE=3 SV=1 33 353 7.0E-96
sp|A2C3I4|BIOB_PROM1 Biotin synthase OS=Prochlorococcus marinus (strain NATL1A) GN=bioB PE=3 SV=1 33 341 9.0E-96
sp|Q1Q8S6|BIOB_PSYCK Biotin synthase OS=Psychrobacter cryohalolentis (strain K5) GN=bioB PE=3 SV=1 36 341 1.0E-95
sp|Q46K32|BIOB_PROMT Biotin synthase OS=Prochlorococcus marinus (strain NATL2A) GN=bioB PE=3 SV=1 33 341 1.0E-95
sp|Q1LTL8|BIOB_BAUCH Biotin synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=bioB PE=3 SV=1 36 342 2.0E-95
sp|P44987|BIOB_HAEIN Biotin synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioB PE=3 SV=1 36 342 2.0E-95
sp|A5UD65|BIOB_HAEIE Biotin synthase OS=Haemophilus influenzae (strain PittEE) GN=bioB PE=3 SV=1 36 342 2.0E-95
sp|Q4QLQ0|BIOB_HAEI8 Biotin synthase OS=Haemophilus influenzae (strain 86-028NP) GN=bioB PE=3 SV=1 36 342 2.0E-95
sp|P57378|BIOB_BUCAI Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=bioB PE=3 SV=1 33 324 2.0E-95
sp|Q1MRA1|BIOB_LAWIP Biotin synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=bioB PE=3 SV=2 33 346 2.0E-95
sp|Q89AK5|BIOB_BUCBP Biotin synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioB PE=3 SV=1 33 341 6.0E-95
sp|B8D7I5|BIOB_BUCAT Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=bioB PE=3 SV=1 33 324 6.0E-95
sp|Q5PA14|BIOB_ANAMM Biotin synthase OS=Anaplasma marginale (strain St. Maries) GN=bioB PE=3 SV=1 31 341 7.0E-95
sp|B9KGM2|BIOB_ANAMF Biotin synthase OS=Anaplasma marginale (strain Florida) GN=bioB PE=3 SV=1 31 341 7.0E-95
sp|Q3AX82|BIOB_SYNS9 Biotin synthase OS=Synechococcus sp. (strain CC9902) GN=bioB PE=3 SV=1 32 355 8.0E-95
sp|Q2GLB4|BIOB_ANAPZ Biotin synthase OS=Anaplasma phagocytophilum (strain HZ) GN=bioB PE=3 SV=1 31 353 8.0E-95
sp|B8D983|BIOB_BUCA5 Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=bioB PE=3 SV=1 33 324 9.0E-95
sp|Q4FQJ9|BIOB_PSYA2 Biotin synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=bioB PE=3 SV=1 13 341 1.0E-94
sp|B8EMZ5|BIOB_METSB Biotin synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=bioB PE=3 SV=1 32 335 1.0E-94
sp|B1ZFX7|BIOB_METPB Biotin synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=bioB PE=3 SV=1 21 341 2.0E-94
sp|Q5L5F9|BIOB_CHLAB Biotin synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=bioB PE=3 SV=1 36 347 2.0E-94
sp|A9BB12|BIOB_PROM4 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=bioB PE=3 SV=1 16 342 5.0E-94
sp|Q12NN4|BIOB_SHEDO Biotin synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=bioB PE=3 SV=1 33 341 6.0E-94
sp|A4YQS3|BIOB_BRASO Biotin synthase OS=Bradyrhizobium sp. (strain ORS278) GN=bioB PE=3 SV=1 33 353 8.0E-94
sp|A3MYI9|BIOB_ACTP2 Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=bioB PE=3 SV=1 23 341 8.0E-94
sp|Q5FPC9|BIOB_GLUOX Biotin synthase OS=Gluconobacter oxydans (strain 621H) GN=bioB PE=3 SV=2 33 348 1.0E-93
sp|A9W8M8|BIOB_METEP Biotin synthase OS=Methylobacterium extorquens (strain PA1) GN=bioB PE=3 SV=1 33 341 1.0E-93
sp|B7KN34|BIOB_METC4 Biotin synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=bioB PE=3 SV=1 33 341 1.0E-93
sp|B0BS22|BIOB_ACTPJ Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=bioB PE=3 SV=1 23 341 1.0E-93
sp|B3GZV8|BIOB_ACTP7 Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=bioB PE=3 SV=1 23 341 1.0E-93
sp|Q9AMS7|BIOB_BRADU Biotin synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bioB PE=3 SV=1 33 341 2.0E-93
sp|A1B1Z0|BIOB1_PARDP Biotin synthase 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=bioB1 PE=3 SV=1 31 341 2.0E-93
sp|A6VNF1|BIOB_ACTSZ Biotin synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=bioB PE=3 SV=1 36 342 2.0E-93
sp|Q7VVF1|BIOB_BORPE Biotin synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bioB PE=3 SV=2 36 344 3.0E-93
sp|Q21W43|BIOB_RHOFT Biotin synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=bioB PE=3 SV=1 36 324 3.0E-93
sp|A9I023|BIOB_BORPD Biotin synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=bioB PE=3 SV=1 36 347 3.0E-93
sp|Q7WB85|BIOB_BORPA Biotin synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bioB PE=3 SV=1 36 344 3.0E-93
sp|Q7WMQ3|BIOB_BORBR Biotin synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bioB PE=3 SV=1 36 344 3.0E-93
sp|Q0I355|BIOB_HAES1 Biotin synthase OS=Haemophilus somnus (strain 129Pt) GN=bioB PE=3 SV=1 36 342 4.0E-93
sp|A2SGQ6|BIOB_METPP Biotin synthase OS=Methylibium petroleiphilum (strain PM1) GN=bioB PE=3 SV=1 36 341 6.0E-93
sp|A9HRF2|BIOB_GLUDA Biotin synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=bioB PE=3 SV=2 33 341 1.0E-92
sp|A1IRY3|BIOB_NEIMA Biotin synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=bioB PE=3 SV=1 32 367 1.0E-92
sp|Q9JRW7|BIOB_NEIMB Biotin synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=bioB1 PE=3 SV=1 32 367 2.0E-92
sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2 1149 2710 2.0E-92
sp|Q9CNP8|BIOB_PASMU Biotin synthase OS=Pasteurella multocida (strain Pm70) GN=bioB PE=3 SV=1 32 342 3.0E-92
sp|Q4UM45|BIOB_RICFE Biotin synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=bioB PE=3 SV=1 36 341 3.0E-92
sp|B0UUK6|BIOB_HISS2 Biotin synthase OS=Histophilus somni (strain 2336) GN=bioB PE=3 SV=1 36 342 5.0E-92
sp|A1WVM7|BIOB_HALHL Biotin synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioB PE=3 SV=1 35 341 6.0E-92
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 1149 2710 1.0E-91
sp|Q65SD0|BIOB_MANSM Biotin synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=bioB PE=3 SV=1 36 342 1.0E-91
sp|Q7VMH0|BIOB_HAEDU Biotin synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=bioB PE=3 SV=1 36 341 2.0E-91
sp|A4SV63|BIOB_POLSQ Biotin synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=bioB PE=3 SV=1 36 342 2.0E-91
sp|Q3AJ51|BIOB_SYNSC Biotin synthase OS=Synechococcus sp. (strain CC9605) GN=bioB PE=3 SV=1 33 341 2.0E-91
sp|A9LZ69|BIOB_NEIM0 Biotin synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=bioB PE=3 SV=2 32 367 3.0E-91
sp|Q3SLY0|BIOB_THIDA Biotin synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=bioB PE=3 SV=1 40 344 3.0E-91
sp|Q12F39|BIOB1_POLSJ Biotin synthase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioB1 PE=3 SV=1 36 341 6.0E-91
sp|B4RLI6|BIOB_NEIG2 Biotin synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=bioB PE=3 SV=2 32 367 6.0E-91
sp|Q5F8G2|BIOB_NEIG1 Biotin synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=bioB PE=3 SV=1 32 367 6.0E-91
sp|A1KU01|BIOB_NEIMF Biotin synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=bioB PE=3 SV=2 32 367 7.0E-91
sp|A1TQ53|BIOB_ACIAC Biotin synthase OS=Acidovorax citrulli (strain AAC00-1) GN=bioB PE=3 SV=1 35 343 1.0E-90
sp|A2BX80|BIOB_PROM5 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=bioB PE=3 SV=1 22 348 1.0E-90
sp|Q7V101|BIOB_PROMP Biotin synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=bioB PE=3 SV=1 33 348 1.0E-90
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 1149 2710 3.0E-90
sp|A1W7J6|BIOB_ACISJ Biotin synthase OS=Acidovorax sp. (strain JS42) GN=bioB PE=3 SV=1 25 343 7.0E-90
sp|B9MJH4|BIOB_ACIET Biotin synthase OS=Acidovorax ebreus (strain TPSY) GN=bioB PE=3 SV=1 25 343 7.0E-90
sp|Q7U7P8|BIOB_SYNPX Biotin synthase OS=Synechococcus sp. (strain WH8102) GN=bioB PE=3 SV=1 33 342 9.0E-90
sp|A5UIF3|BIOB_HAEIG Biotin synthase OS=Haemophilus influenzae (strain PittGG) GN=bioB PE=3 SV=1 36 342 2.0E-89
sp|Q2GDF4|BIOB_NEOSM Biotin synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=bioB PE=3 SV=2 36 333 4.0E-89
sp|F1QFR9|PSM4A_DANRE Proteasome activator complex subunit 4A OS=Danio rerio GN=psme4a PE=3 SV=2 1142 2710 4.0E-89
sp|Q7VBJ0|BIOB_PROMA Biotin synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=bioB PE=3 SV=1 32 341 7.0E-89
sp|B0U0S3|BIOB_FRAP2 Biotin synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=bioB PE=3 SV=1 39 342 9.0E-89
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 1149 2710 1.0E-88
sp|Q5NGB2|BIOB_FRATT Biotin synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=bioB PE=3 SV=1 39 342 1.0E-88
sp|Q14HR4|BIOB_FRAT1 Biotin synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=bioB PE=3 SV=1 39 342 1.0E-88
sp|A4IXP5|BIOB_FRATW Biotin synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=bioB PE=3 SV=1 39 342 2.0E-88
sp|A0Q638|BIOB_FRATN Biotin synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=bioB PE=3 SV=1 39 342 2.0E-88
sp|Q0BLD5|BIOB_FRATO Biotin synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=bioB PE=3 SV=1 39 342 3.0E-88
sp|Q2A2V9|BIOB_FRATH Biotin synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=bioB PE=3 SV=1 39 342 3.0E-88
sp|A7NCW7|BIOB_FRATF Biotin synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=bioB PE=3 SV=1 39 342 3.0E-88
sp|B2SGE3|BIOB_FRATM Biotin synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=bioB PE=3 SV=1 39 342 4.0E-88
sp|Q0IBC8|BIOB_SYNS3 Biotin synthase OS=Synechococcus sp. (strain CC9311) GN=bioB PE=3 SV=2 33 342 8.0E-88
sp|Q7V6T8|BIOB_PROMM Biotin synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=bioB PE=3 SV=1 31 341 1.0E-87
sp|A2C8D5|BIOB_PROM3 Biotin synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=bioB PE=3 SV=1 31 341 2.0E-87
sp|Q3J561|BIOB_RHOS4 Biotin synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=bioB PE=3 SV=1 33 341 1.0E-86
sp|A3PH74|BIOB_RHOS1 Biotin synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=bioB PE=3 SV=1 33 341 4.0E-86
sp|B9KM96|BIOB_RHOSK Biotin synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=bioB PE=3 SV=1 33 341 1.0E-85
sp|A8IJU8|BIOB_AZOC5 Biotin synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=bioB PE=3 SV=1 42 341 1.0E-85
sp|A5GS37|BIOB_SYNR3 Biotin synthase OS=Synechococcus sp. (strain RCC307) GN=bioB PE=3 SV=1 28 324 5.0E-85
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 1149 2710 6.0E-84
sp|P94966|BIOB_METSK Biotin synthase OS=Methylobacillus sp. (strain KT1) GN=bioB PE=3 SV=2 36 341 2.0E-79
sp|B3DV36|BIOB_METI4 Biotin synthase OS=Methylacidiphilum infernorum (isolate V4) GN=bioB PE=3 SV=2 41 341 3.0E-76
sp|Q899M1|BIOB_CLOTE Biotin synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=bioB PE=3 SV=1 45 341 1.0E-60
sp|B9E2A2|BIOB_CLOK1 Biotin synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=bioB PE=3 SV=1 68 342 5.0E-59
sp|A9A5K6|BIOB_NITMS Biotin synthase OS=Nitrosopumilus maritimus (strain SCM1) GN=bioB PE=3 SV=1 39 341 6.0E-59
sp|B1I4G4|BIOB_DESAP Biotin synthase OS=Desulforudis audaxviator (strain MP104C) GN=bioB PE=3 SV=1 68 343 1.0E-57
sp|B0TE53|BIOB_HELMI Biotin synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=bioB PE=3 SV=1 32 341 3.0E-57
sp|A3DBD3|BIOB_CLOTH Biotin synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioB PE=3 SV=1 67 342 4.0E-57
sp|B2UNW0|BIOB_AKKM8 Biotin synthase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=bioB PE=3 SV=1 38 342 7.0E-57
sp|A0PYU9|BIOB_CLONN Biotin synthase OS=Clostridium novyi (strain NT) GN=bioB PE=3 SV=1 50 341 9.0E-57
sp|A7I1A0|BIOB_CAMHC Biotin synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=bioB PE=3 SV=1 41 348 2.0E-55
sp|B4U973|BIOB_HYDS0 Biotin synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=bioB PE=3 SV=1 52 348 2.0E-55
sp|Q8REU0|BIOB_FUSNN Biotin synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=bioB PE=3 SV=1 50 342 3.0E-54
sp|Q18D35|BIOB_PEPD6 Biotin synthase OS=Peptoclostridium difficile (strain 630) GN=bioB PE=3 SV=1 43 342 6.0E-54
sp|A5D4Y6|BIOB_PELTS Biotin synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=bioB PE=3 SV=1 49 324 1.0E-53
sp|Q8XK59|BIOB_CLOPE Biotin synthase OS=Clostridium perfringens (strain 13 / Type A) GN=bioB PE=3 SV=1 38 341 1.0E-53
sp|B1XNE1|BIOB_SYNP2 Biotin synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bioB PE=3 SV=1 56 343 2.0E-53
sp|Q6NHL3|BIOB2_CORDI Biotin synthase 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=bioB2 PE=3 SV=1 38 340 4.0E-53
sp|O67104|BIOB_AQUAE Biotin synthase OS=Aquifex aeolicus (strain VF5) GN=bioB PE=3 SV=1 40 296 4.0E-53
sp|C0QVM0|BIOB_BRAHW Biotin synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=bioB PE=3 SV=1 31 340 4.0E-53
sp|Q3ADP5|BIOB_CARHZ Biotin synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=bioB PE=3 SV=1 61 342 2.0E-52
sp|Q0TQ59|BIOB_CLOP1 Biotin synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=bioB PE=3 SV=1 38 341 3.0E-52
sp|P73538|BIOB_SYNY3 Biotin synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bioB PE=3 SV=1 69 343 4.0E-52
sp|A5I427|BIOB_CLOBH Biotin synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=bioB PE=3 SV=1 49 342 6.0E-52
sp|A7FVS6|BIOB_CLOB1 Biotin synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=bioB PE=3 SV=1 49 342 6.0E-52
sp|B5YK85|BIOB_THEYD Biotin synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=bioB PE=3 SV=1 41 342 6.0E-52
sp|A7GFJ9|BIOB_CLOBL Biotin synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=bioB PE=3 SV=1 49 342 2.0E-51
sp|Q10YQ3|BIOB_TRIEI Biotin synthase OS=Trichodesmium erythraeum (strain IMS101) GN=bioB PE=3 SV=1 52 343 5.0E-51
sp|A4J1M3|BIOB_DESRM Biotin synthase OS=Desulfotomaculum reducens (strain MI-1) GN=bioB PE=3 SV=1 67 324 5.0E-51
sp|A0RW96|BIOB_CENSY Biotin synthase OS=Cenarchaeum symbiosum (strain A) GN=bioB PE=3 SV=1 38 343 5.0E-51
sp|B1IHH9|BIOB_CLOBK Biotin synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=bioB PE=3 SV=1 49 342 1.0E-50
sp|B1KW08|BIOB_CLOBM Biotin synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=bioB PE=3 SV=1 49 342 2.0E-50
sp|A6LUQ4|BIOB_CLOB8 Biotin synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=bioB PE=3 SV=1 67 341 3.0E-50
sp|A0QX70|BIOB_MYCS2 Biotin synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=bioB PE=3 SV=1 74 336 1.0E-49
sp|Q8FUD1|BIOB_COREF Biotin synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=bioB PE=3 SV=1 67 341 1.0E-49
sp|Q740Q9|BIOB_MYCPA Biotin synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=bioB PE=3 SV=1 68 336 2.0E-49
sp|A0QHJ1|BIOB_MYCA1 Biotin synthase OS=Mycobacterium avium (strain 104) GN=bioB PE=3 SV=1 68 336 3.0E-49
sp|A6TT61|BIOB_ALKMQ Biotin synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=bioB PE=3 SV=1 69 341 3.0E-49
sp|A1VB97|BIOB_DESVV Biotin synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=bioB PE=3 SV=1 50 341 3.0E-49
sp|Q6NKC7|BIOB1_CORDI Biotin synthase 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=bioB1 PE=3 SV=1 67 338 7.0E-49
sp|Q728P5|BIOB_DESVH Biotin synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=bioB PE=3 SV=2 50 341 7.0E-49
sp|Q5YYR3|BIOB_NOCFA Biotin synthase OS=Nocardia farcinica (strain IFM 10152) GN=bioB PE=3 SV=1 68 337 8.0E-49
sp|C6C0T2|BIOB_DESAD Biotin synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=bioB PE=3 SV=1 67 341 1.0E-48
sp|B8HPP0|BIOB_CYAP4 Biotin synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=bioB PE=3 SV=2 61 343 2.0E-48
sp|B7GKT8|BIOB_ANOFW Biotin synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioB PE=3 SV=2 44 354 3.0E-48
sp|Q3INU3|BIOB_NATPD Biotin synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=bioB PE=3 SV=1 61 366 3.0E-48
sp|Q8KZM7|BIOB_BACNA Biotin synthase OS=Bacillus subtilis subsp. natto GN=bioB PE=3 SV=1 61 342 5.0E-48
sp|A4T9L9|BIOB_MYCGI Biotin synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=bioB PE=3 SV=1 49 336 5.0E-48
sp|B7KFJ9|BIOB_CYAP7 Biotin synthase OS=Cyanothece sp. (strain PCC 7424) GN=bioB PE=3 SV=1 52 343 6.0E-48
sp|C0QR28|BIOB_PERMH Biotin synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=bioB PE=3 SV=1 50 353 7.0E-48
sp|P9WPQ7|BIOB_MYCTU Biotin synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioB PE=1 SV=1 68 336 9.0E-48
sp|P9WPQ6|BIOB_MYCTO Biotin synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioB PE=3 SV=1 68 336 9.0E-48
sp|A5WMR0|BIOB_MYCTF Biotin synthase OS=Mycobacterium tuberculosis (strain F11) GN=bioB PE=3 SV=1 68 336 9.0E-48
sp|A5U2U5|BIOB_MYCTA Biotin synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=bioB PE=3 SV=1 68 336 9.0E-48
sp|A1KJ05|BIOB_MYCBP Biotin synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=bioB PE=3 SV=1 68 336 9.0E-48
sp|P0A507|BIOB_MYCBO Biotin synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=bioB PE=3 SV=1 68 336 9.0E-48
sp|B5ECN1|BIOB_GEOBB Biotin synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=bioB PE=3 SV=1 40 342 1.0E-47
sp|P53557|BIOB_BACSU Biotin synthase OS=Bacillus subtilis (strain 168) GN=bioB PE=3 SV=1 61 342 1.0E-47
sp|B7K1U3|BIOB_CYAP8 Biotin synthase OS=Cyanothece sp. (strain PCC 8801) GN=bioB PE=3 SV=1 52 343 1.0E-47
sp|A4QA10|BIOB_CORGB Biotin synthase OS=Corynebacterium glutamicum (strain R) GN=bioB PE=3 SV=1 67 341 2.0E-47
sp|P46396|BIOB_CORGL Biotin synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=bioB PE=3 SV=3 67 341 2.0E-47
sp|B9M305|BIOB_GEODF Biotin synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=bioB PE=3 SV=1 40 324 3.0E-47
sp|B1WTI3|BIOB_CYAA5 Biotin synthase OS=Cyanothece sp. (strain ATCC 51142) GN=bioB PE=3 SV=2 52 343 3.0E-47
sp|B0JFP4|BIOB_MICAN Biotin synthase OS=Microcystis aeruginosa (strain NIES-843) GN=bioB PE=3 SV=1 61 343 3.0E-47
sp|Q9KC26|BIOB_BACHD Biotin synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioB PE=3 SV=1 44 342 4.0E-47
sp|Q4JWG3|BIOB_CORJK Biotin synthase OS=Corynebacterium jeikeium (strain K411) GN=bioB PE=3 SV=1 69 341 4.0E-47
sp|B3E599|BIOB_GEOLS Biotin synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=bioB PE=3 SV=1 53 331 5.0E-47
sp|A0PP05|BIOB_MYCUA Biotin synthase OS=Mycobacterium ulcerans (strain Agy99) GN=bioB PE=3 SV=1 68 336 5.0E-47
sp|B2HQ93|BIOB_MYCMM Biotin synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=bioB PE=3 SV=1 68 336 6.0E-47
sp|Q0SHW6|BIOB_RHOJR Biotin synthase OS=Rhodococcus jostii (strain RHA1) GN=bioB PE=3 SV=2 40 336 6.0E-47
sp|P46715|BIOB_MYCLE Biotin synthase OS=Mycobacterium leprae (strain TN) GN=bioB PE=3 SV=2 68 336 7.0E-47
sp|B8ZR86|BIOB_MYCLB Biotin synthase OS=Mycobacterium leprae (strain Br4923) GN=bioB PE=3 SV=1 68 336 7.0E-47
sp|Q8CQB3|BIOB_STAES Biotin synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=bioB PE=3 SV=1 31 342 9.0E-47
sp|Q97MI6|BIOB_CLOAB Biotin synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bioB PE=3 SV=1 61 331 1.0E-46
sp|Q5HKJ7|BIOB_STAEQ Biotin synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=bioB PE=3 SV=1 51 342 1.0E-46
sp|B2V167|BIOB_CLOBA Biotin synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=bioB PE=3 SV=1 67 335 1.0E-46
sp|B1MBZ3|BIOB_MYCA9 Biotin synthase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=bioB PE=3 SV=1 68 336 1.0E-46
sp|Q30XZ5|BIOB_DESAG Biotin synthase OS=Desulfovibrio alaskensis (strain G20) GN=bioB PE=3 SV=1 50 331 1.0E-46
sp|A1T8V0|BIOB_MYCVP Biotin synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=bioB PE=3 SV=1 69 336 1.0E-46
sp|A0LJA8|BIOB_SYNFM Biotin synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=bioB PE=3 SV=1 51 318 2.0E-46
sp|Q8DL38|BIOB_THEEB Biotin synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=bioB PE=3 SV=1 38 341 3.0E-46
sp|Q0RD46|BIOB_FRAAA Biotin synthase OS=Frankia alni (strain ACN14a) GN=bioB PE=3 SV=1 68 336 3.0E-46
sp|Q7M8P7|BIOB_WOLSU Biotin synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=bioB PE=3 SV=1 67 342 4.0E-46
sp|B2TL73|BIOB_CLOBB Biotin synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=bioB PE=3 SV=1 67 335 5.0E-46
sp|A8LUR1|BIOB_SALAI Biotin synthase OS=Salinispora arenicola (strain CNS-205) GN=bioB PE=3 SV=1 68 336 5.0E-46
sp|A4X585|BIOB_SALTO Biotin synthase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=bioB PE=3 SV=1 68 336 6.0E-46
sp|Q65MK9|BIOB_BACLD Biotin synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=bioB PE=3 SV=1 52 342 1.0E-45
sp|A5IK57|BIOB_THEP1 Biotin synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=bioB PE=3 SV=1 40 336 1.0E-45
sp|B2V8G9|BIOB_SULSY Biotin synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=bioB PE=3 SV=1 40 351 1.0E-45
sp|A0LTP8|BIOB_ACIC1 Biotin synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=bioB PE=3 SV=1 49 328 2.0E-45
sp|Q7UF84|BIOB_RHOBA Biotin synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=bioB PE=3 SV=1 61 352 2.0E-45
sp|Q818X3|BIOB_BACCR Biotin synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=bioB PE=3 SV=1 53 353 3.0E-45
sp|A7Z5B2|BIOB_BACMF Biotin synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=bioB PE=3 SV=1 39 342 4.0E-45
sp|Q70JZ1|BIOB_BACAM Biotin synthase OS=Bacillus amyloliquefaciens GN=bioB PE=3 SV=1 39 342 4.0E-45
sp|A6LD84|BIOB_PARD8 Biotin synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=bioB PE=3 SV=1 44 340 5.0E-45
sp|Q2LY09|BIOB_SYNAS Biotin synthase OS=Syntrophus aciditrophicus (strain SB) GN=bioB PE=3 SV=1 51 323 5.0E-45
sp|B1GYW9|BIOB_UNCTG Biotin synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=bioB PE=3 SV=1 38 342 7.0E-45
sp|P19206|BIOB_LYSSH Biotin synthase OS=Lysinibacillus sphaericus GN=bioB PE=1 SV=1 49 342 7.0E-45
sp|Q6AK48|BIOB_DESPS Biotin synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=bioB PE=3 SV=1 64 324 9.0E-45
sp|Q5SKN6|BIOB_THET8 Biotin synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=bioB PE=3 SV=1 61 335 1.0E-44
sp|B2RH08|BIOB_PORG3 Biotin synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=bioB PE=3 SV=2 60 342 1.0E-44
sp|Q1B7F4|BIOB_MYCSS Biotin synthase OS=Mycobacterium sp. (strain MCS) GN=bioB PE=3 SV=1 69 336 1.0E-44
sp|A1UHL9|BIOB_MYCSK Biotin synthase OS=Mycobacterium sp. (strain KMS) GN=bioB PE=3 SV=1 69 336 1.0E-44
sp|A3Q142|BIOB_MYCSJ Biotin synthase OS=Mycobacterium sp. (strain JLS) GN=bioB PE=3 SV=1 69 336 1.0E-44
sp|A0JTA3|BIOB_ARTS2 Biotin synthase OS=Arthrobacter sp. (strain FB24) GN=bioB PE=3 SV=1 61 336 1.0E-44
sp|Q5KZN1|BIOB_GEOKA Biotin synthase OS=Geobacillus kaustophilus (strain HTA426) GN=bioB PE=3 SV=1 34 342 1.0E-44
sp|A4IN84|BIOB_GEOTN Biotin synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=bioB PE=3 SV=1 49 342 1.0E-44
sp|A8EWX7|BIOB_ARCB4 Biotin synthase OS=Arcobacter butzleri (strain RM4018) GN=bioB PE=3 SV=1 67 335 2.0E-44
sp|Q72L21|BIOB_THET2 Biotin synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=bioB PE=3 SV=1 67 342 2.0E-44
sp|B7IWM8|BIOB_BACC2 Biotin synthase OS=Bacillus cereus (strain G9842) GN=bioB PE=3 SV=1 53 353 2.0E-44
sp|Q7MT97|BIOB_PORGI Biotin synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=bioB PE=3 SV=1 68 342 2.0E-44
sp|E6SRG2|BIOAB_BACT6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 67 340 2.0E-44
sp|B9KBR9|BIOB_THENN Biotin synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=bioB PE=3 SV=1 68 336 2.0E-44
sp|B3QLR7|BIOB_CHLP8 Biotin synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=bioB PE=3 SV=1 47 338 2.0E-44
sp|B9IWX7|BIOB_BACCQ Biotin synthase OS=Bacillus cereus (strain Q1) GN=bioB PE=3 SV=1 53 329 3.0E-44
sp|B7HNN1|BIOB_BACC7 Biotin synthase OS=Bacillus cereus (strain AH187) GN=bioB PE=3 SV=1 53 329 3.0E-44
sp|A9VG53|BIOB_BACWK Biotin synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=bioB PE=3 SV=1 53 329 3.0E-44
sp|B9DKN5|BIOB_STACT Biotin synthase OS=Staphylococcus carnosus (strain TM300) GN=bioB PE=3 SV=1 31 362 3.0E-44
sp|A1R3R7|BIOB_ARTAT Biotin synthase OS=Arthrobacter aurescens (strain TC1) GN=bioB PE=3 SV=1 61 336 3.0E-44
sp|Q731I2|BIOB_BACC1 Biotin synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=bioB PE=3 SV=1 53 329 3.0E-44
sp|B4S690|BIOB_PROA2 Biotin synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=bioB PE=3 SV=1 48 336 3.0E-44
sp|B1HRT3|BIOB_LYSSC Biotin synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=bioB PE=3 SV=1 49 342 4.0E-44
sp|B7HAY7|BIOB_BACC4 Biotin synthase OS=Bacillus cereus (strain B4264) GN=bioB PE=3 SV=1 53 353 5.0E-44
sp|A7GSD8|BIOB_BACCN Biotin synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=bioB PE=3 SV=1 53 324 7.0E-44
sp|Q8KGB6|BIOB_CHLTE Biotin synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=bioB PE=3 SV=1 46 323 9.0E-44
sp|A5G3Q7|BIOB_GEOUR Biotin synthase OS=Geobacter uraniireducens (strain Rf4) GN=bioB PE=3 SV=1 40 324 1.0E-43
sp|B8HDH4|BIOB_ARTCA Biotin synthase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=bioB PE=3 SV=1 61 336 2.0E-43
sp|Q2J6H8|BIOB1_FRASC Biotin synthase 1 OS=Frankia sp. (strain CcI3) GN=bioB1 PE=3 SV=1 49 323 2.0E-43
sp|A0RIB6|BIOB_BACAH Biotin synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=bioB PE=3 SV=1 53 329 2.0E-43
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 757 970 6.0E-10
sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2 756 970 4.0E-09
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 756 970 5.0E-09
sp|F1QFR9|PSM4A_DANRE Proteasome activator complex subunit 4A OS=Danio rerio GN=psme4a PE=3 SV=2 757 970 6.0E-09
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 756 970 4.0E-08
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 756 970 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011170
MLSSSSRIAGLSFRRTLATHASASSEHVAKITRHNWRRQEIKDIYNSPLMDLVFRATSIHRQHHDPQKIQLCTLM
NIKTGGCSEDCSYCSQSSRYSTPTTASKLLEVDPVIEAARKAKENGSTRFCMGAAWRDLSGRKRGFERILEMVRE
VRGMGMEVCTTLGMLSPEQARKLKEAGLTAYNHNLDTSREFYPQVITTRSYDDRLETINAVRDAGISVCSGGILG
LGETDADRIGLIWEISCMPEHPESFPVNALVPIPGTPLENNEPVPHHTLVRTIATARIVLPTTIIRLAAGRNTLS
EAEQVMCFMAGANAVFTGDQMLTTPCSPWDEDKALMGRWGLEGMSSFEQSSVARKEGERLAAEVSSGECASTIGT
PDFCYNISETGLYSRSPDCWVLARVQSALCLAWSLIGICRWLRANSTNGPDMADLPSVPLSDHNMWYYPSHGQHS
DEEDISIGFKTGNWGCKTVKGARWVRRGKITPWGPGMEDWEAEERARKRLTMLLPQDRRSPSPPTLPHLSRSPSP
PLTSPYPPPTSTHLSYSSFVLDKSTTYTFRSKLLDELEHATNGLIEGEATLRHALGRLWQVMSEDPDHEEFAVPV
VTKMEDEDESREEEQDERSKRVMRAPDLTPATHKIFINSEADLANHDSHFSQPETQLESLQKSILLLKELQDNGR
EYVERLQEIREGLGDVRAQRNTIWDMRIWLDYLSLRFPTTMALPDIGQLHINGLLPQPSLPQDIVDTNGSREMEK
LKNLARLLPYSVEPNSQMQQMLDLIMRRIYQAVEAQDYDIGFLQWDTMLAFWVSLKYPIPKEKRIALAKLYFELS
ITPGMPMSAVASCADGFRLLTRNKKTLTVEDMRLPWKPIYDILSQDLFLTRRQFEYTQLSWCMGYMADNARRFFH
PAAINDMLSTFVPLIDGTKLDSVLSSHYYLMTFLPLSHPQTYLPMLLRLWESINSYKYDERMLHLLSKVAEMHVV
PEISDPHKIAQIPDDAISDGETRPNWSKDTGQVDDSYWPGLYKSVGIFTDHEWNLFMCKCLASMEISLADGGSLT
TGPTADNVAGFEIGRLPKPQWRIVSLAKIIVYSMAPDGIPVPASNAPTPMFSPLPSGMNTPQPQNPASSIGDYLG
SSLNKRAYVPQKTYLAGSKALDSLARLIASTESFFHPSNSGTWTQDLSAFIKCIASEFNKRWFEEQKPDCKTPLN
RRLTKQMKRELVKSMRTVALLAMFSPDSSVVNNIQGCLKSMCVMEPDLILEPILQRAVPSLEALTETHRTLAVIK
ALGAVAPAIVSRQVYYGGAKHLVPILELLIPGIDLNDPSKTLCTTSFLVEISQYITIGDLTGFDDAVSRSDTEPT
LPPEPTYALPSLSFDDIDEFADLTTKLTPDEEDALLKDSTGSFPDWISSFIRRVIQLLENLPEEGPNGSSGGATE
VQVVDAVAGACSQICVHLSEPLFDMVLNMVYDYASTNVRTNAVRAIHQLVECVANANPVKTLAKFFPMCVTNIKT
ELDNGASSLRTTSASQPLPSDATLHWNLAILRGAVYNDGRAILKYEEDIIPLLRFLRDKTFSKRGYSWTGKLLSS
LLLTVTHTYPLENKFVNPAEWNSQEFRKNHHRYWGKRYAQGEVEVSWHVPSKAAIEFALRIFRELVEPTMDILEA
LMKSDVPRDANWRNDFCRYLTFVRNAFAGIPTLCEERIPKEYFETLISTSDILDEIPEMIANVDPIKSGFCLTDP
SDPKFIFITTLRKRFGRFLHEASVALRQQGEENTVDAVQILVRSMRTYFLEYADSRDSSQVNGDSYTQEKNIARL
YIGQKTWPRAVYVRRARFYSSARLRWNAIERSRGPLEDCLIDDLVEWSIWHYPVIRQSGQSVLESIANVYDGVRR
RALPVLFKALEPGEDDDRMKGALWTINYSAFGKYALSEPRLSLTTVKHLFGCQHNEKPSLQNCVSVVFENCLNSF
SEPCHVIYNVAKPRVDHALAYLKTIIVETEDDRKLVCRCREKRISRIQKIDEVSQQIITHVLDLSNSGKLHWRYS
IYAVRCLRTLVRRDIPVQANQMRYFLTKLHDNHPTIRYYSQRAVMKSIRSIKLRTYCKKPADLALMNVSNPLKCS
VTVKSSRQTTPDFLNAYKIPVDISIPSAEPTFHDKDPPGWLIWSRNVDMYRVPDPIRSTFQPWDSLCDESISTVL
DITTDQKYWEKISVYYSEENQESVMIQDNVSCVKSIFQLLEDKPFSAFKPVVEKFIADKDQNKQRAAAELLAGVL
GGSKHWPTQKQNALWAWFIPHMRHIFSQNIKTDTLPIWSSFVEYMLYHRDPRRVQPLVDHIVASFKALDYNAEMA
FDAVKVITFYRSFYEELGRKFLPWTDEAVERSWAEISSEHDDVRAYIGDILVFSENIKWQPKPSCPETEAFVREC
QIVPADYDIMGMRGTYHRTRVLQLVDHFRTWRQERLPGVRAFQSTYDRVGTTVCKWLYLSLHDLHAISAFDYILP
LMSEIFRFTELNDNDDLATRASRLLVRMCGVTPPVPLVNPILDAIFHTIQNSPSWKVRLKALPLVQVFYFRQLPL
IPEIKIVEMLEVLCRCLDDEVVEVREMAAVTLSGILRLSPRRSILTLKDRFVRLLKNSHIPSRNDANYNKAIRQR
HAAILGICALVESYPYTVEKWLPELLTGVLAEHTYDPIPISTTVRNCASNFKRTHQDTWHEDCKRFNEDQLASLS
TLLSGSSYYA*
Coding >AgabiH97|011170
ATGCTCTCGTCATCTTCTCGGATAGCGGGATTATCATTTCGTCGGACTCTAGCCACTCATGCCTCCGCATCTTCG
GAGCATGTAGCGAAGATCACTAGACACAATTGGAGAAGACAAGAGATCAAAGACATATACAATAGCCCGTTGATG
GATCTTGTCTTCCGTGCGACCTCCATCCATCGCCAGCACCATGATCCCCAAAAGATCCAGCTATGTACTCTCATG
AACATCAAAACTGGAGGATGCAGCGAGGATTGCTCTTACTGTTCGCAGTCGTCGAGGTACTCAACTCCGACAACG
GCTTCGAAACTTCTTGAAGTAGATCCTGTTATCGAAGCGGCACGCAAAGCAAAAGAAAACGGAAGTACTCGATTT
TGCATGGGTGCAGCTTGGAGAGATCTTTCAGGACGCAAGCGTGGATTCGAAAGGATCCTAGAAATGGTCCGCGAA
GTTCGCGGAATGGGTATGGAGGTCTGCACTACGCTGGGTATGCTCAGCCCGGAACAAGCACGAAAACTAAAAGAA
GCGGGACTTACTGCCTACAACCACAATTTGGACACCTCTCGTGAGTTTTATCCACAGGTCATCACTACCCGGTCC
TATGATGACAGGCTGGAAACCATAAACGCCGTCCGCGATGCTGGCATCAGTGTGTGTTCGGGTGGAATCTTGGGA
CTGGGAGAGACCGATGCCGATCGTATTGGCCTTATCTGGGAAATTTCTTGTATGCCGGAGCATCCAGAATCTTTC
CCGGTGAATGCGCTCGTGCCAATACCTGGTACTCCACTCGAAAACAACGAGCCTGTGCCCCATCATACCCTTGTG
CGCACCATTGCGACGGCGCGGATAGTTCTTCCCACCACCATCATCCGTCTAGCTGCCGGGAGAAACACACTTTCA
GAGGCTGAGCAGGTCATGTGCTTTATGGCTGGAGCTAATGCTGTCTTCACTGGTGATCAGATGCTCACCACCCCT
TGTTCGCCATGGGATGAGGATAAGGCTCTTATGGGCCGATGGGGTCTTGAGGGCATGAGCAGTTTCGAACAATCC
AGTGTTGCAAGGAAGGAGGGTGAGAGGCTCGCCGCGGAGGTTAGCAGCGGAGAATGTGCATCTACGATCGGTACA
CCTGATTTCTGCTACAATATCAGTGAGACGGGGTTATACTCGCGGAGTCCTGATTGCTGGGTGCTGGCGAGGGTT
CAATCTGCCTTGTGCTTGGCCTGGTCATTGATCGGGATATGCCGATGGTTACGCGCCAACTCCACCAATGGTCCA
GATATGGCCGACCTTCCCTCCGTTCCATTGAGTGATCACAATATGTGGTATTATCCCTCTCATGGGCAACATTCC
GACGAAGAAGACATAAGTATTGGATTCAAGACAGGGAATTGGGGTTGCAAAACTGTGAAGGGAGCGCGGTGGGTA
AGAAGGGGCAAAATTACGCCCTGGGGTCCAGGGATGGAGGACTGGGAGGCCGAGGAACGCGCTCGCAAGCGCTTG
ACGATGTTACTACCACAGGACCGCCGCTCTCCTTCTCCCCCGACGCTCCCTCATCTCTCACGCTCCCCTTCGCCA
CCCCTCACCTCACCTTATCCCCCACCTACATCTACACACCTCAGCTACTCTTCTTTCGTCCTTGACAAATCCACA
ACATATACATTCCGCTCAAAGCTACTCGATGAACTCGAGCATGCAACGAATGGTTTAATTGAAGGGGAAGCTACG
CTACGACATGCTCTGGGAAGGCTCTGGCAGGTCATGAGTGAGGACCCTGATCATGAAGAGTTCGCGGTTCCGGTG
GTGACGAAAATGGAAGATGAAGACGAAAGCCGAGAAGAGGAGCAAGATGAAAGGAGCAAAAGGGTCATGCGCGCA
CCCGACCTCACTCCGGCGACACATAAAATATTCATTAACAGTGAAGCAGATTTGGCTAATCATGATTCTCATTTC
AGCCAGCCAGAAACGCAGTTGGAAAGCCTGCAGAAATCAATATTGCTGTTAAAGGAACTACAGGACAACGGCCGG
GAGTACGTGGAACGGCTCCAAGAGATTAGAGAAGGTTTAGGCGATGTGCGGGCTCAGCGGAATACAATATGGGAT
ATGCGTATCTGGCTGGATTACCTATCACTCCGCTTTCCAACCACTATGGCGTTGCCAGATATTGGCCAACTCCAT
ATCAATGGCCTACTGCCTCAACCATCCCTTCCTCAAGACATAGTAGATACAAATGGAAGTCGAGAAATGGAGAAA
TTGAAGAACCTGGCGCGTCTGCTTCCTTATTCCGTTGAACCAAATTCGCAGATGCAACAAATGTTGGACTTGATT
ATGCGGCGAATCTATCAAGCAGTAGAGGCGCAGGATTATGACATTGGATTTTTACAATGGGATACTATGTTGGCC
TTTTGGGTTTCGCTCAAGTATCCGATTCCCAAGGAGAAGCGAATTGCGCTCGCAAAACTATATTTTGAGCTTAGC
ATCACGCCTGGTATGCCCATGTCAGCGGTAGCCAGCTGCGCCGATGGGTTCCGACTCCTGACGCGGAACAAGAAG
ACCTTGACTGTGGAAGACATGAGACTCCCGTGGAAACCAATCTATGATATCCTCAGCCAAGATCTCTTCCTGACT
CGACGACAATTCGAATACACTCAACTTTCGTGGTGTATGGGTTACATGGCCGACAATGCTCGTAGATTTTTTCAT
CCTGCCGCTATCAATGACATGCTTTCAACCTTCGTGCCTTTGATCGATGGAACCAAGTTAGACAGTGTTCTGTCT
TCTCATTACTATCTCATGACCTTCCTACCTCTTTCTCATCCTCAAACTTATCTTCCAATGTTACTCCGCCTTTGG
GAGTCCATTAACTCATACAAGTATGATGAGCGGATGTTACACCTTCTCTCAAAAGTAGCAGAGATGCACGTTGTC
CCCGAAATCAGCGACCCTCATAAGATCGCACAAATCCCTGATGATGCCATCTCAGATGGAGAGACGAGACCCAAT
TGGTCAAAAGATACTGGCCAGGTTGATGATTCGTATTGGCCTGGTCTGTATAAGAGTGTCGGTATTTTTACCGAT
CATGAGTGGAATCTATTTATGTGTAAATGTCTGGCATCCATGGAGATTTCCCTTGCCGATGGAGGTTCGCTAACT
ACCGGTCCGACGGCGGACAATGTCGCTGGCTTCGAAATTGGCAGGCTCCCGAAACCGCAGTGGCGTATTGTTTCG
TTGGCAAAGATCATTGTATACTCCATGGCGCCTGATGGAATTCCAGTTCCGGCCTCGAATGCACCCACCCCCATG
TTTTCACCACTCCCATCCGGGATGAACACGCCTCAGCCACAAAACCCCGCTTCATCGATTGGGGACTACCTTGGA
TCGTCTTTGAATAAGAGGGCGTATGTCCCTCAAAAAACGTATCTTGCCGGTTCGAAGGCATTAGATTCTCTTGCC
CGTTTGATTGCTTCCACCGAGAGCTTTTTCCATCCCTCTAATTCTGGCACGTGGACGCAAGATCTAAGTGCGTTC
ATCAAGTGCATCGCATCCGAATTCAACAAGCGTTGGTTTGAGGAGCAGAAGCCGGACTGTAAGACACCTTTGAAT
CGAAGATTGACGAAGCAAATGAAACGCGAACTGGTGAAATCTATGAGAACGGTGGCACTTTTAGCAATGTTTTCG
CCAGACTCATCGGTTGTCAACAATATTCAAGGGTGCCTGAAGTCCATGTGCGTCATGGAACCGGATCTGATCCTG
GAGCCTATCTTACAACGGGCTGTTCCTTCCCTCGAGGCGTTGACCGAGACCCACCGGACCCTTGCTGTGATCAAA
GCTTTAGGCGCGGTAGCGCCAGCTATCGTGTCTCGCCAGGTTTATTATGGAGGTGCTAAGCATCTCGTACCAATT
CTTGAGTTGCTTATACCTGGAATTGATCTCAATGATCCCTCGAAAACGCTTTGTACGACCTCTTTCCTGGTTGAA
ATCTCTCAATATATAACGATCGGAGACTTGACCGGTTTCGACGACGCTGTATCTCGGAGTGACACCGAACCGACT
CTCCCACCCGAGCCTACTTATGCGTTACCTTCACTATCATTTGATGATATTGATGAGTTCGCGGACTTGACTACC
AAGTTGACCCCAGATGAGGAAGATGCTTTGCTCAAGGATTCAACTGGTAGTTTCCCAGACTGGATATCGAGTTTC
ATACGTCGTGTGATCCAACTATTAGAGAATCTACCCGAAGAAGGGCCGAACGGTTCTAGTGGAGGGGCGACAGAA
GTTCAGGTCGTCGATGCAGTTGCTGGCGCATGCAGTCAAATTTGTGTACATCTGTCGGAGCCGCTCTTCGACATG
GTTTTGAATATGGTCTATGATTATGCCAGCACGAACGTTCGAACCAATGCTGTCCGGGCCATCCACCAGCTGGTG
GAATGTGTAGCAAATGCCAATCCTGTGAAGACTTTGGCCAAGTTTTTCCCAATGTGTGTCACAAATATCAAGACT
GAGCTCGACAATGGGGCTAGTTCGTTGAGAACCACTTCCGCTTCACAACCGTTGCCATCCGATGCGACTTTACAT
TGGAATCTTGCGATCCTCCGGGGTGCCGTTTATAACGATGGACGCGCTATATTAAAATACGAGGAAGATATCATT
CCTTTGCTTCGTTTTCTCAGGGATAAGACCTTCTCCAAGCGCGGTTATTCCTGGACCGGAAAACTGCTGTCCAGC
CTACTGCTGACCGTCACTCACACATATCCCCTCGAAAACAAATTTGTGAATCCTGCAGAATGGAACAGCCAAGAA
TTTCGCAAGAACCACCATCGCTACTGGGGCAAGCGTTATGCTCAGGGCGAAGTAGAAGTCTCATGGCATGTGCCC
TCAAAAGCGGCGATCGAATTCGCACTTCGGATCTTTAGGGAATTAGTCGAGCCGACTATGGATATTCTAGAAGCA
TTGATGAAATCTGATGTACCACGGGATGCAAACTGGCGTAATGACTTTTGCAGGTATCTAACATTCGTCCGCAAT
GCATTTGCTGGAATACCGACCCTGTGTGAGGAACGTATTCCTAAAGAATATTTTGAGACTTTAATATCTACGAGT
GATATCCTAGACGAGATTCCAGAAATGATAGCCAACGTAGATCCAATCAAATCTGGTTTCTGTCTCACCGATCCC
TCCGATCCCAAGTTCATTTTCATAACTACTCTGAGAAAGAGGTTCGGTCGATTCTTGCATGAGGCGTCCGTTGCC
CTACGTCAACAGGGCGAGGAGAATACTGTTGATGCTGTTCAGATTTTGGTGAGATCTATGCGGACATACTTCCTT
GAATACGCCGACAGCAGAGATAGCTCTCAAGTTAACGGGGATAGTTACACCCAAGAGAAGAACATTGCACGACTC
TACATTGGACAAAAGACATGGCCTCGAGCGGTATATGTCCGAAGAGCGAGATTTTATTCATCCGCTCGATTGAGG
TGGAATGCAATAGAGCGTTCTCGGGGACCACTCGAAGATTGTCTGATTGACGATCTCGTGGAATGGTCAATCTGG
CATTATCCCGTTATCCGACAATCTGGTCAATCTGTATTGGAATCCATTGCAAACGTCTATGATGGAGTGCGACGG
CGTGCTCTTCCCGTTTTATTCAAGGCTCTTGAACCAGGGGAAGATGATGATCGAATGAAAGGTGCCCTGTGGACC
ATAAATTACTCAGCATTTGGCAAATATGCTTTGTCCGAACCTAGGCTGTCCTTGACGACGGTCAAGCACCTGTTT
GGCTGCCAACACAACGAAAAGCCTTCTCTACAGAATTGTGTGTCCGTCGTGTTTGAAAACTGCCTGAATAGTTTT
TCTGAACCATGCCATGTCATCTATAATGTTGCCAAACCGAGAGTGGATCATGCCCTTGCGTACTTGAAAACCATT
ATCGTTGAAACTGAGGATGACCGAAAACTTGTGTGCCGATGTCGCGAAAAAAGGATCAGCAGAATCCAAAAGATT
GACGAAGTTTCACAACAGATTATAACCCATGTTCTGGATCTGTCCAACTCAGGAAAGCTGCATTGGCGGTACTCC
ATCTATGCCGTTCGCTGCTTGCGCACACTTGTCCGGAGAGACATTCCTGTGCAGGCAAATCAGATGCGCTATTTT
CTGACCAAGTTGCACGACAACCATCCCACAATTCGATATTATTCTCAGAGAGCCGTGATGAAAAGCATCCGATCC
ATCAAACTTCGTACCTATTGTAAAAAACCCGCGGACCTTGCCCTTATGAATGTTTCTAATCCATTGAAATGTTCC
GTCACGGTGAAATCCTCTCGCCAAACCACGCCCGATTTCCTGAATGCCTACAAAATTCCGGTTGACATCTCAATC
CCGAGCGCTGAACCAACATTCCATGACAAGGATCCCCCAGGTTGGCTGATTTGGAGTAGGAATGTGGATATGTAC
CGCGTTCCAGATCCGATTCGATCCACTTTTCAACCCTGGGATTCTTTGTGCGACGAAAGCATCTCAACGGTACTT
GATATCACCACCGACCAGAAATACTGGGAGAAGATATCCGTCTACTACTCCGAGGAGAACCAGGAATCTGTCATG
ATCCAGGACAACGTGTCGTGTGTCAAATCAATTTTCCAGCTTCTCGAAGATAAACCTTTCTCTGCTTTCAAACCC
GTAGTAGAGAAGTTTATCGCTGACAAAGACCAAAACAAGCAACGTGCCGCAGCAGAACTCCTCGCTGGGGTCCTA
GGAGGCTCCAAGCATTGGCCGACTCAGAAACAAAACGCCCTATGGGCTTGGTTCATACCCCATATGAGACATATT
TTCTCGCAGAACATTAAGACCGATACTTTACCCATTTGGTCTTCATTCGTAGAGTACATGCTGTACCATCGGGAT
CCGCGAAGAGTTCAACCCTTGGTGGACCACATTGTCGCGTCCTTCAAAGCCCTGGATTATAACGCGGAAATGGCA
TTTGATGCTGTCAAAGTTATCACATTCTATAGATCTTTCTACGAAGAACTCGGGAGAAAATTTTTGCCATGGACG
GACGAGGCGGTAGAACGTTCTTGGGCTGAAATATCCAGCGAACATGACGATGTACGCGCGTATATAGGAGACATT
TTGGTTTTTTCCGAGAACATAAAGTGGCAACCCAAGCCATCATGTCCAGAGACGGAGGCTTTTGTAAGGGAATGT
CAAATCGTTCCTGCAGATTATGACATAATGGGGATGAGAGGCACCTATCATAGGACAAGGGTGCTTCAGCTAGTT
GATCATTTTAGGACTTGGCGTCAGGAACGTCTGCCCGGAGTGCGAGCATTCCAATCTACGTATGATCGAGTTGGA
ACAACTGTGTGCAAATGGCTCTATCTGTCCCTTCATGATCTTCATGCCATTTCGGCTTTCGATTATATACTCCCT
CTGATGTCCGAAATCTTCCGATTCACAGAACTCAATGACAATGATGACCTTGCCACAAGGGCAAGTCGGCTCCTA
GTGCGGATGTGTGGCGTAACCCCTCCTGTGCCACTAGTTAATCCTATATTGGATGCGATCTTCCACACGATTCAG
AATTCGCCTTCTTGGAAGGTTCGGCTTAAGGCTCTACCGCTGGTCCAAGTGTTCTATTTCCGACAGCTTCCGTTG
ATTCCGGAAATCAAAATCGTTGAAATGCTTGAAGTCCTCTGCCGATGTCTTGATGATGAAGTGGTGGAAGTGCGG
GAGATGGCAGCCGTCACACTCTCTGGGATTCTACGTTTATCGCCGCGGCGCAGTATTCTGACACTCAAAGATCGA
TTCGTGAGGTTGTTGAAGAACAGTCACATCCCCAGTCGAAATGATGCAAACTATAATAAAGCGATACGCCAGAGG
CACGCAGCCATATTAGGAATCTGCGCACTGGTGGAAAGTTATCCTTATACGGTCGAGAAGTGGTTGCCCGAATTG
CTTACGGGTGTGTTGGCGGAGCACACATATGATCCAATCCCGATTTCGACAACAGTGCGCAATTGTGCCAGTAAC
TTCAAAAGAACGCATCAAGATACCTGGCACGAAGATTGTAAACGTTTCAATGAGGACCAGCTCGCATCATTATCT
ACTTTGCTATCCGGCTCGTCGTATTATGCTTAA
Transcript >AgabiH97|011170
ATGCTCTCGTCATCTTCTCGGATAGCGGGATTATCATTTCGTCGGACTCTAGCCACTCATGCCTCCGCATCTTCG
GAGCATGTAGCGAAGATCACTAGACACAATTGGAGAAGACAAGAGATCAAAGACATATACAATAGCCCGTTGATG
GATCTTGTCTTCCGTGCGACCTCCATCCATCGCCAGCACCATGATCCCCAAAAGATCCAGCTATGTACTCTCATG
AACATCAAAACTGGAGGATGCAGCGAGGATTGCTCTTACTGTTCGCAGTCGTCGAGGTACTCAACTCCGACAACG
GCTTCGAAACTTCTTGAAGTAGATCCTGTTATCGAAGCGGCACGCAAAGCAAAAGAAAACGGAAGTACTCGATTT
TGCATGGGTGCAGCTTGGAGAGATCTTTCAGGACGCAAGCGTGGATTCGAAAGGATCCTAGAAATGGTCCGCGAA
GTTCGCGGAATGGGTATGGAGGTCTGCACTACGCTGGGTATGCTCAGCCCGGAACAAGCACGAAAACTAAAAGAA
GCGGGACTTACTGCCTACAACCACAATTTGGACACCTCTCGTGAGTTTTATCCACAGGTCATCACTACCCGGTCC
TATGATGACAGGCTGGAAACCATAAACGCCGTCCGCGATGCTGGCATCAGTGTGTGTTCGGGTGGAATCTTGGGA
CTGGGAGAGACCGATGCCGATCGTATTGGCCTTATCTGGGAAATTTCTTGTATGCCGGAGCATCCAGAATCTTTC
CCGGTGAATGCGCTCGTGCCAATACCTGGTACTCCACTCGAAAACAACGAGCCTGTGCCCCATCATACCCTTGTG
CGCACCATTGCGACGGCGCGGATAGTTCTTCCCACCACCATCATCCGTCTAGCTGCCGGGAGAAACACACTTTCA
GAGGCTGAGCAGGTCATGTGCTTTATGGCTGGAGCTAATGCTGTCTTCACTGGTGATCAGATGCTCACCACCCCT
TGTTCGCCATGGGATGAGGATAAGGCTCTTATGGGCCGATGGGGTCTTGAGGGCATGAGCAGTTTCGAACAATCC
AGTGTTGCAAGGAAGGAGGGTGAGAGGCTCGCCGCGGAGGTTAGCAGCGGAGAATGTGCATCTACGATCGGTACA
CCTGATTTCTGCTACAATATCAGTGAGACGGGGTTATACTCGCGGAGTCCTGATTGCTGGGTGCTGGCGAGGGTT
CAATCTGCCTTGTGCTTGGCCTGGTCATTGATCGGGATATGCCGATGGTTACGCGCCAACTCCACCAATGGTCCA
GATATGGCCGACCTTCCCTCCGTTCCATTGAGTGATCACAATATGTGGTATTATCCCTCTCATGGGCAACATTCC
GACGAAGAAGACATAAGTATTGGATTCAAGACAGGGAATTGGGGTTGCAAAACTGTGAAGGGAGCGCGGTGGGTA
AGAAGGGGCAAAATTACGCCCTGGGGTCCAGGGATGGAGGACTGGGAGGCCGAGGAACGCGCTCGCAAGCGCTTG
ACGATGTTACTACCACAGGACCGCCGCTCTCCTTCTCCCCCGACGCTCCCTCATCTCTCACGCTCCCCTTCGCCA
CCCCTCACCTCACCTTATCCCCCACCTACATCTACACACCTCAGCTACTCTTCTTTCGTCCTTGACAAATCCACA
ACATATACATTCCGCTCAAAGCTACTCGATGAACTCGAGCATGCAACGAATGGTTTAATTGAAGGGGAAGCTACG
CTACGACATGCTCTGGGAAGGCTCTGGCAGGTCATGAGTGAGGACCCTGATCATGAAGAGTTCGCGGTTCCGGTG
GTGACGAAAATGGAAGATGAAGACGAAAGCCGAGAAGAGGAGCAAGATGAAAGGAGCAAAAGGGTCATGCGCGCA
CCCGACCTCACTCCGGCGACACATAAAATATTCATTAACAGTGAAGCAGATTTGGCTAATCATGATTCTCATTTC
AGCCAGCCAGAAACGCAGTTGGAAAGCCTGCAGAAATCAATATTGCTGTTAAAGGAACTACAGGACAACGGCCGG
GAGTACGTGGAACGGCTCCAAGAGATTAGAGAAGGTTTAGGCGATGTGCGGGCTCAGCGGAATACAATATGGGAT
ATGCGTATCTGGCTGGATTACCTATCACTCCGCTTTCCAACCACTATGGCGTTGCCAGATATTGGCCAACTCCAT
ATCAATGGCCTACTGCCTCAACCATCCCTTCCTCAAGACATAGTAGATACAAATGGAAGTCGAGAAATGGAGAAA
TTGAAGAACCTGGCGCGTCTGCTTCCTTATTCCGTTGAACCAAATTCGCAGATGCAACAAATGTTGGACTTGATT
ATGCGGCGAATCTATCAAGCAGTAGAGGCGCAGGATTATGACATTGGATTTTTACAATGGGATACTATGTTGGCC
TTTTGGGTTTCGCTCAAGTATCCGATTCCCAAGGAGAAGCGAATTGCGCTCGCAAAACTATATTTTGAGCTTAGC
ATCACGCCTGGTATGCCCATGTCAGCGGTAGCCAGCTGCGCCGATGGGTTCCGACTCCTGACGCGGAACAAGAAG
ACCTTGACTGTGGAAGACATGAGACTCCCGTGGAAACCAATCTATGATATCCTCAGCCAAGATCTCTTCCTGACT
CGACGACAATTCGAATACACTCAACTTTCGTGGTGTATGGGTTACATGGCCGACAATGCTCGTAGATTTTTTCAT
CCTGCCGCTATCAATGACATGCTTTCAACCTTCGTGCCTTTGATCGATGGAACCAAGTTAGACAGTGTTCTGTCT
TCTCATTACTATCTCATGACCTTCCTACCTCTTTCTCATCCTCAAACTTATCTTCCAATGTTACTCCGCCTTTGG
GAGTCCATTAACTCATACAAGTATGATGAGCGGATGTTACACCTTCTCTCAAAAGTAGCAGAGATGCACGTTGTC
CCCGAAATCAGCGACCCTCATAAGATCGCACAAATCCCTGATGATGCCATCTCAGATGGAGAGACGAGACCCAAT
TGGTCAAAAGATACTGGCCAGGTTGATGATTCGTATTGGCCTGGTCTGTATAAGAGTGTCGGTATTTTTACCGAT
CATGAGTGGAATCTATTTATGTGTAAATGTCTGGCATCCATGGAGATTTCCCTTGCCGATGGAGGTTCGCTAACT
ACCGGTCCGACGGCGGACAATGTCGCTGGCTTCGAAATTGGCAGGCTCCCGAAACCGCAGTGGCGTATTGTTTCG
TTGGCAAAGATCATTGTATACTCCATGGCGCCTGATGGAATTCCAGTTCCGGCCTCGAATGCACCCACCCCCATG
TTTTCACCACTCCCATCCGGGATGAACACGCCTCAGCCACAAAACCCCGCTTCATCGATTGGGGACTACCTTGGA
TCGTCTTTGAATAAGAGGGCGTATGTCCCTCAAAAAACGTATCTTGCCGGTTCGAAGGCATTAGATTCTCTTGCC
CGTTTGATTGCTTCCACCGAGAGCTTTTTCCATCCCTCTAATTCTGGCACGTGGACGCAAGATCTAAGTGCGTTC
ATCAAGTGCATCGCATCCGAATTCAACAAGCGTTGGTTTGAGGAGCAGAAGCCGGACTGTAAGACACCTTTGAAT
CGAAGATTGACGAAGCAAATGAAACGCGAACTGGTGAAATCTATGAGAACGGTGGCACTTTTAGCAATGTTTTCG
CCAGACTCATCGGTTGTCAACAATATTCAAGGGTGCCTGAAGTCCATGTGCGTCATGGAACCGGATCTGATCCTG
GAGCCTATCTTACAACGGGCTGTTCCTTCCCTCGAGGCGTTGACCGAGACCCACCGGACCCTTGCTGTGATCAAA
GCTTTAGGCGCGGTAGCGCCAGCTATCGTGTCTCGCCAGGTTTATTATGGAGGTGCTAAGCATCTCGTACCAATT
CTTGAGTTGCTTATACCTGGAATTGATCTCAATGATCCCTCGAAAACGCTTTGTACGACCTCTTTCCTGGTTGAA
ATCTCTCAATATATAACGATCGGAGACTTGACCGGTTTCGACGACGCTGTATCTCGGAGTGACACCGAACCGACT
CTCCCACCCGAGCCTACTTATGCGTTACCTTCACTATCATTTGATGATATTGATGAGTTCGCGGACTTGACTACC
AAGTTGACCCCAGATGAGGAAGATGCTTTGCTCAAGGATTCAACTGGTAGTTTCCCAGACTGGATATCGAGTTTC
ATACGTCGTGTGATCCAACTATTAGAGAATCTACCCGAAGAAGGGCCGAACGGTTCTAGTGGAGGGGCGACAGAA
GTTCAGGTCGTCGATGCAGTTGCTGGCGCATGCAGTCAAATTTGTGTACATCTGTCGGAGCCGCTCTTCGACATG
GTTTTGAATATGGTCTATGATTATGCCAGCACGAACGTTCGAACCAATGCTGTCCGGGCCATCCACCAGCTGGTG
GAATGTGTAGCAAATGCCAATCCTGTGAAGACTTTGGCCAAGTTTTTCCCAATGTGTGTCACAAATATCAAGACT
GAGCTCGACAATGGGGCTAGTTCGTTGAGAACCACTTCCGCTTCACAACCGTTGCCATCCGATGCGACTTTACAT
TGGAATCTTGCGATCCTCCGGGGTGCCGTTTATAACGATGGACGCGCTATATTAAAATACGAGGAAGATATCATT
CCTTTGCTTCGTTTTCTCAGGGATAAGACCTTCTCCAAGCGCGGTTATTCCTGGACCGGAAAACTGCTGTCCAGC
CTACTGCTGACCGTCACTCACACATATCCCCTCGAAAACAAATTTGTGAATCCTGCAGAATGGAACAGCCAAGAA
TTTCGCAAGAACCACCATCGCTACTGGGGCAAGCGTTATGCTCAGGGCGAAGTAGAAGTCTCATGGCATGTGCCC
TCAAAAGCGGCGATCGAATTCGCACTTCGGATCTTTAGGGAATTAGTCGAGCCGACTATGGATATTCTAGAAGCA
TTGATGAAATCTGATGTACCACGGGATGCAAACTGGCGTAATGACTTTTGCAGGTATCTAACATTCGTCCGCAAT
GCATTTGCTGGAATACCGACCCTGTGTGAGGAACGTATTCCTAAAGAATATTTTGAGACTTTAATATCTACGAGT
GATATCCTAGACGAGATTCCAGAAATGATAGCCAACGTAGATCCAATCAAATCTGGTTTCTGTCTCACCGATCCC
TCCGATCCCAAGTTCATTTTCATAACTACTCTGAGAAAGAGGTTCGGTCGATTCTTGCATGAGGCGTCCGTTGCC
CTACGTCAACAGGGCGAGGAGAATACTGTTGATGCTGTTCAGATTTTGGTGAGATCTATGCGGACATACTTCCTT
GAATACGCCGACAGCAGAGATAGCTCTCAAGTTAACGGGGATAGTTACACCCAAGAGAAGAACATTGCACGACTC
TACATTGGACAAAAGACATGGCCTCGAGCGGTATATGTCCGAAGAGCGAGATTTTATTCATCCGCTCGATTGAGG
TGGAATGCAATAGAGCGTTCTCGGGGACCACTCGAAGATTGTCTGATTGACGATCTCGTGGAATGGTCAATCTGG
CATTATCCCGTTATCCGACAATCTGGTCAATCTGTATTGGAATCCATTGCAAACGTCTATGATGGAGTGCGACGG
CGTGCTCTTCCCGTTTTATTCAAGGCTCTTGAACCAGGGGAAGATGATGATCGAATGAAAGGTGCCCTGTGGACC
ATAAATTACTCAGCATTTGGCAAATATGCTTTGTCCGAACCTAGGCTGTCCTTGACGACGGTCAAGCACCTGTTT
GGCTGCCAACACAACGAAAAGCCTTCTCTACAGAATTGTGTGTCCGTCGTGTTTGAAAACTGCCTGAATAGTTTT
TCTGAACCATGCCATGTCATCTATAATGTTGCCAAACCGAGAGTGGATCATGCCCTTGCGTACTTGAAAACCATT
ATCGTTGAAACTGAGGATGACCGAAAACTTGTGTGCCGATGTCGCGAAAAAAGGATCAGCAGAATCCAAAAGATT
GACGAAGTTTCACAACAGATTATAACCCATGTTCTGGATCTGTCCAACTCAGGAAAGCTGCATTGGCGGTACTCC
ATCTATGCCGTTCGCTGCTTGCGCACACTTGTCCGGAGAGACATTCCTGTGCAGGCAAATCAGATGCGCTATTTT
CTGACCAAGTTGCACGACAACCATCCCACAATTCGATATTATTCTCAGAGAGCCGTGATGAAAAGCATCCGATCC
ATCAAACTTCGTACCTATTGTAAAAAACCCGCGGACCTTGCCCTTATGAATGTTTCTAATCCATTGAAATGTTCC
GTCACGGTGAAATCCTCTCGCCAAACCACGCCCGATTTCCTGAATGCCTACAAAATTCCGGTTGACATCTCAATC
CCGAGCGCTGAACCAACATTCCATGACAAGGATCCCCCAGGTTGGCTGATTTGGAGTAGGAATGTGGATATGTAC
CGCGTTCCAGATCCGATTCGATCCACTTTTCAACCCTGGGATTCTTTGTGCGACGAAAGCATCTCAACGGTACTT
GATATCACCACCGACCAGAAATACTGGGAGAAGATATCCGTCTACTACTCCGAGGAGAACCAGGAATCTGTCATG
ATCCAGGACAACGTGTCGTGTGTCAAATCAATTTTCCAGCTTCTCGAAGATAAACCTTTCTCTGCTTTCAAACCC
GTAGTAGAGAAGTTTATCGCTGACAAAGACCAAAACAAGCAACGTGCCGCAGCAGAACTCCTCGCTGGGGTCCTA
GGAGGCTCCAAGCATTGGCCGACTCAGAAACAAAACGCCCTATGGGCTTGGTTCATACCCCATATGAGACATATT
TTCTCGCAGAACATTAAGACCGATACTTTACCCATTTGGTCTTCATTCGTAGAGTACATGCTGTACCATCGGGAT
CCGCGAAGAGTTCAACCCTTGGTGGACCACATTGTCGCGTCCTTCAAAGCCCTGGATTATAACGCGGAAATGGCA
TTTGATGCTGTCAAAGTTATCACATTCTATAGATCTTTCTACGAAGAACTCGGGAGAAAATTTTTGCCATGGACG
GACGAGGCGGTAGAACGTTCTTGGGCTGAAATATCCAGCGAACATGACGATGTACGCGCGTATATAGGAGACATT
TTGGTTTTTTCCGAGAACATAAAGTGGCAACCCAAGCCATCATGTCCAGAGACGGAGGCTTTTGTAAGGGAATGT
CAAATCGTTCCTGCAGATTATGACATAATGGGGATGAGAGGCACCTATCATAGGACAAGGGTGCTTCAGCTAGTT
GATCATTTTAGGACTTGGCGTCAGGAACGTCTGCCCGGAGTGCGAGCATTCCAATCTACGTATGATCGAGTTGGA
ACAACTGTGTGCAAATGGCTCTATCTGTCCCTTCATGATCTTCATGCCATTTCGGCTTTCGATTATATACTCCCT
CTGATGTCCGAAATCTTCCGATTCACAGAACTCAATGACAATGATGACCTTGCCACAAGGGCAAGTCGGCTCCTA
GTGCGGATGTGTGGCGTAACCCCTCCTGTGCCACTAGTTAATCCTATATTGGATGCGATCTTCCACACGATTCAG
AATTCGCCTTCTTGGAAGGTTCGGCTTAAGGCTCTACCGCTGGTCCAAGTGTTCTATTTCCGACAGCTTCCGTTG
ATTCCGGAAATCAAAATCGTTGAAATGCTTGAAGTCCTCTGCCGATGTCTTGATGATGAAGTGGTGGAAGTGCGG
GAGATGGCAGCCGTCACACTCTCTGGGATTCTACGTTTATCGCCGCGGCGCAGTATTCTGACACTCAAAGATCGA
TTCGTGAGGTTGTTGAAGAACAGTCACATCCCCAGTCGAAATGATGCAAACTATAATAAAGCGATACGCCAGAGG
CACGCAGCCATATTAGGAATCTGCGCACTGGTGGAAAGTTATCCTTATACGGTCGAGAAGTGGTTGCCCGAATTG
CTTACGGGTGTGTTGGCGGAGCACACATATGATCCAATCCCGATTTCGACAACAGTGCGCAATTGTGCCAGTAAC
TTCAAAAGAACGCATCAAGATACCTGGCACGAAGATTGTAAACGTTTCAATGAGGACCAGCTCGCATCATTATCT
ACTTTGCTATCCGGCTCGTCGTATTATGCTTAA
Gene >AgabiH97|011170
ATGCTCTCGTCATCTTCTCGGATAGCGGGATTATCATTTCGTCGGACTCTAGCCACTCATGCCTCCGCATCTTCG
GAGCATGTAGCGAAGATCACTAGACACAATTGGAGAAGACAAGAGATCAAAGACATATACAATAGCCCGTTGATG
GATCTTGTCTTCCGTGCGACCTCCATCCATCGCCAGCACCATGATCCCCAAAAGATCCAGCTATGTACTCTCATG
AACATCAAAAGTATGCTTTATAACCGTTCTAACTCCTGATATCTCTTTGTTGAATTATCTCTGTACAGCTGGAGG
ATGCAGCGAGGATTGTAATTCTTCCCATTGTTCTCCGAGAGTTATGCTTGACTGTACTACTAGGCTCTTACTGTT
CGCAGTCGTCGAGGTACTCAACTCCGACAACGGCTTCGAAACTTCTTGAAGTAGATCCTGTTATCGAAGCGGCAC
GCAAAGCAAAAGAAAACGGAAGTACTCGATTTTGCATGGGTGCAGCTTGGAGAGATCTTTCAGGACGCAAGCGTG
GATTCGAAAGGATCCTAGAAATGGTCCGCGAAGTTCGCGGAATGGGTATGGAGGTCTGCACTACGCTGGGTATGC
TCAGCCCGGAACAAGCACGAAAACTAAAAGAAGCGTGAGTATATAAGCTTTCTGAATCGCCGACCTGTGGCTTAT
CATCCTGATAGGGGACTTACTGCCTACAACCACAATTTGGACACCTCTCGTGAGTTTTATCCACAGGTAAGTTTC
CTTGATCGTAGCTGGTATTTTTAATTCATGATTTTTGAGGTCATCACTACCCGGTCCTATGATGACAGGCTGGAA
ACCATAAACGCCGTCCGCGATGCTGGCATCAGTGTGTGTTCGGGTGGAATCTTGGGACTGGGAGAGACCGATGCC
GATCGTATTGGCCTTATCTGGGAAATTTCTTGGTAAGTTCAGATGGGCAACTCGGTTAAGACAAATATCTTAACG
AGAGCTTTAAGTATGCCGGAGCATCCAGAATCTTTCCCGGTGAATGCGCTCGTGCCAATACCTGGTACTCCACTC
GAAAACAACGAGGTAAATAAACATCTTCAATGATTAATCATATTTATCGCTCAGTGTCTGCGATAGCCTGTGCCC
CATCATACCCTTGTGCGCACCATTGCGACGGCGCGGATAGTTCTTCCCACCACCATCATCCGTCTAGCTGCCGGG
AGAAACACACTTTCAGAGGCTGAGCAGGTCATGTGCTTTATGGCTGGAGCTAATGCTGTCTTCACTGGTGATCAG
ATGCTCACCACCCCTTGTTCGCCATGGGATGAGGTCAGTTTTTTTTTTCCGATGTGCGATCTCTGAACGGTTATT
CATATAATACCAACAGGATAAGGCTCTTATGGGCCGATGGGGTCTTGAGGGCATGAGCAGTTTCGAACAATCCAG
TGTTGCAAGGAAGGAGGGTGAGAGGCTCGCCGGTACATCTAGTTCTCAAACCGTTGAAACTGGAGCAAAAATCTA
AATTTAGCAGCGGAGGTTAGCAGCGGAGGTTGACCGTTGAAGCCTCTGTACTTTTAGCGATATATAGAAACTTAT
CTAGAATGTGCATCTACGATCGGTACACCTGATTTCTGCTACAATATCAGTGAGACGGGGTTATACTCGCGGAGT
CCTGATTGCTGGGTGCTGGCGAGGGTTCAATCTGCCTTGTGCTTGGCCTGGTCATTGATCGGGATATGCCGATGT
GCCTCAAGTTATCATTAACCCAGTATCCAATTCTCACTTTTCGAATAGGGTTACGCGCCAACTCCACCAGTGACA
ACGACCAATGAGCACCGTGGGCAATCGCAAACGACGCTATGGGCAGATAGATGGTCCAGAGTCAGTAGCTATGTA
TTCCGTTTCTTCGCTGCCGTGCTCTAACAGTCATCACAGTATGGCCGACCTTCCCTCCGTTCCATTGAGTGATCA
CAATATGTGGTATTATCCCTCTCATGGGCAACATTCCGACGAAGAAGACATAAGTATTGGATTCAAGACAGGGAA
TTGGGGTTGCAAAACTGTGAAGGGAGCGCGGTGGGTAAGAAGGGGCAAAATTACGCCCTGGGGTCCAGGGATGGA
GGACTGGGAGGTGAGCCTACTGAGCGATGCCCGTAATTCTCTGCCTGACAATACAGGCCGAGGAACGCGCTCGCA
AGCGCTTGACGATGTTACTACCACAGGACCGCCGCTCTCCTTCTCCCCCGACGCTCCCTCATCTCTCACGCTCCC
CTTCGCCACCCCTCACCTCACCTTATCCCCCACCTACATCTACACACCTCAGCTACTCTTCTTTCGTCCTTGACA
AATCCACAACATATACATTCCGCTCAAAGCTACTCGATGAACTCGAGCATGCAACGAATGGTTTAATTGAAGGGG
AAGCTACGCTACGACATGCTCTGGGAAGGCTCTGGCAGGTCATGAGTGAGGACCCTGATCATGAAGAGTTCGCGG
TTCCGGTGGTGACGAAAATGGAAGATGAAGACGAAAGCCGAGAAGAGGAGCAAGATGAAAGGAGCAAAAGGGTCA
TGCGCGCACCCGACCTCACTCCGGCGACACATAAAATATTCATTAACAGTGAAGCAGATTTGGCTAATCATGATT
CTCATTTCAGCCAGCCAGAAACGCAGTTGGAAAGCCTGCAGAAATCAATATTGCTGTTAAAGGAACTACAGGACA
ACGGCCGGGAGTACGTGGAACGGCTCCAAGAGATTAGAGAAGGTTTAGGCGATGTGCGGGCTCAGCGGAATACAA
TATGGGATATGGTGAGGGAGCGCGCCGTAAAAGAACTGCAGGATGTTGCTGTAGCGGGGCATTAATTAATATAAA
AATAAAATTCTTGTCTTGTGCTTGGAGTTGTACTGGTGCCGCCACTCATCCATCTCTAACACCAACCACATCCTA
CTCCATCTTTACTAGTTCCGTAGCGTATCTGGCTGGATTACCTATCACTCCGGTCTGCTCTTATATTGACGCCCA
CTTCCCCCTTCTGCTCACTTCCCCGTCAAGCTTTCCAACCACTATGGCGTTGCCAGATATTGGCCAACTCCATAT
CAATGGCCTACTGCCTCAACCATCCCTTCCTCAAGACATAGTAGATACAAATGGAAGTCGAGAAATGGAGAAATT
GAAGAACCTGGCGCGTCTGCTTCCTTATTCCGTTGAACCAAATTCGCAGATGCAACAAATGTTGGACTTGATTAT
GCGGCGAATCTATCAAGCAGTAGAGGCGCAGGATTATGACATTGGATTTTTACAATGGGATACTATGTTGGCCTT
GTTCGTATCTTTGTTTTTTCCGCAGTGGATGATGCTGATGGCTTATTTACAGTTGGGTTTCGCTCAAGTATCCGA
TTCCCAAGGAGAAGCGAATTGCGCTCGCAAAACTATATTTTGAGCTTAGCATCACGCCTGGTATGCCCATGTCAG
CGGTAGCCAGCTGCGCCGATGGGTTCCGACTCCTGACGCGGAACAAGAAGACCTTGACTGTGGAAGACATGAGAC
TCCCGTGGAAACCAATCTATGATATCCTCAGCCAAGATCTCTTCCTGACTCGACGACAATTCGAATACACGTAAG
TCGAATAACATGTGCTGTTATCGGCTAAACCCTCATCATATTGCCAGTCAACTTTCGTGGTGTATGGGTTACATG
GCCGACAATGCTCGTAGATTTTTTCATCCTGCCGCTATCAATGACATGCTTTCAACCTTCGTGCCTTTGATCGAT
GGAACCAAGTTAGACGTAAGTCCAGATTCATTTCATGCATCCCGGTATTCTCTAATCTTTCTTCGAACAGAGTGT
TCTGTCTTCTCATTACTATCTCATGACCTTCCTACCTCTTTCTCATCCTCAAACTTATCTTCCAATGTTACTCCG
CCTTTGGGAGTCCATTAACTCATACAAGTATGATGAGCGGATGTTACACCTTCTCTCAAAAGTAGCAGAGATGCA
CGTTGTCCCCGAAATCAGCGACCCTCATAAGATCGCACAAATCCCTGATGATGCCATCTCAGATGGAGAGACGAG
ACCCAATTGGTCAAAAGATACTGGCCAGGTTGATGATTCGTATTGGCCTGGTCTGTATAAGAGTGTCGGTATTTT
TACCGATCATGAGTGGAATCTATTTATGTGTAAATGTCTGGCATCCATGGGTGAGCATAAGTGGCAAATTTTATA
TATTGTGAACCCGCTAACAAACCGAATAGAGATTTCCCTTGCCGATGGAGGTTCGCTAACTACCGGTCCGACGGC
GGACAATGTCGCTGGCTTCGAAATTGGCAGGCTCCCGAAACCGCAGTGGCGTATTGGTGCGCTTCTACGAAACCT
TCCCTTCTTTTTTTTCGGACTGATATATTGTTCTAGTTTCGTTGGCAAAGATCATTGTATACTCCATGGCGCCTG
ATGGAATTCCAGTTCCGGCCTCGAATGCACCCACCCCCATGTTTTCACCACTCCCATCCGGGATGAACACGCCTC
AGCCACAAAACCCCGCTTCATCGATTGGGGACTACCTTGGATCGTCTTTGAATAAGAGGGCGTATGTCCCTCAAA
AAACGTATCTTGCCGGTTCGAAGGCATTAGATTCTCTTGCCCGTTTGATTGCTTCCACCGAGAGCTTTTTCCATC
CCTCTAATTCTGGCACGTGGACGCAAGATGTGAGTTTGCCATTAAGCGGACCAACTTTAGGTTACTGAGATCTGA
TCGTGACAGCTAAGTGCGTTCATCAAGTGCATCGCATCCGAATTCAACAAGCGTATGTATTGTGTGTTCTGCTTT
ACATCAAAAAAAATTTACATTTTTACAGGTTGGTTTGAGGAGCAGAAGCCGGACTGTAAGACACCTTTGGTAATA
TCTGAGTTATTTCTTATTGAAGAGGGACTTATTGATCGTACTCTAGAATCGAAGATTGACGAAGCAAATGAAACG
CGAACTGGTGAAATCTATGAGAACGGTGGCACTTTTAGCAATGTTTTCGCCAGACTCATCGGTTGTCAACAATAT
TCAAGGGTGCCTGAAGTCCATGTGCGTCATGGAACCGGATCTGATCCTGGAGCCTATCTTACAACGGGCTGTTCC
TTCCCTCGAGGCGTTGACCGAGGTTCGTGCCAGTATATTTCCAAAACAGCAAAAGTAGTTGATGTTGTTGCCAGA
CCCACCGGACCCTTGCTGTGATCAAAGCTTTAGGCGCGGTAGCGCCAGCTATCGTGTCTCGCCAGGTTTATTATG
GAGGTGCTAAGCATCTCGTACCAATTCTTGAGTTGCTTATACCTGGAATTGATCTCGTGCGTCAGCCTCACTTTT
TCTCGTTGTCCCGCTAACGTATTAACCAACTAGAATGATCCCTCGAAAACGGTATCTCGATCTTTTTCAAATTTG
ATTTGTAAAACACTCATTGAGCGAAATTAGCTTTGTACGACCTCTTTCCTGGTTGAAATCTCTCAATATATAACG
ATCGGAGACTTGACCGGTTTCGACGACGCTGTATCTCGGAGTGACACCGAACCGACTCTCCCACCCGAGCCTACT
TATGCGTTACCTTCACTATCATTTGATGATATTGATGAGTTCGCGGACTTGACTACCAAGTTGACCCCAGATGAG
GAAGATGCTTTGCTCAAGGTAATTTTCTCGCACCACTTGTCATTTCGTGTCGCGTTGATAGATATACAACATACA
GGATTCAACTGGTAGTTTCCCAGACTGGATATCGAGTTTCATACGTCGTGTGATCCAACTATTAGAGAATCTACC
CGAAGAAGGGCCGAACGGTTCTAGTGGAGGGGCGACAGAAGGTACGTTCCCCTTGGTTTTGCATGGACTTATATC
TCATTGTTTTCTAATTATAGTTCAGGTCGTCGATGCAGTTGCTGGCGCATGCAGTCAAATTTGTGTACATCTGTC
GGAGCCGCTCTTCGACATGGTTTTGAATATGGTCTATGATTATGCCAGCACGAACGTTCGAACCAATGCTGTCCG
GGCCATCCACCAGCTGGTGGAATGTGTAGCAAATGCCAATCCTGTGAAGACTTTGGCCAAGTTTTTCCCAATGTG
TGTCACAAATATCAAGACTGAGCTCGACAATGGGGCTAGTTCGTTGAGAACCACTTCCGCTTCACAACCGTTGCC
ATCCGATGCGACTTTACATTGGAATCTTGCGATCCTCCGGGGTGCCGTTTATAAGTACGTCTCTTCTTTCGTGCA
AGATTTCCCTTTCTGAACAAATAATCTATCAGCGATGGACGCGCTGTGTGTTGTAATCTTTGTCGCTGTTCCTGC
AACTTCTGATGTTCGCCTTAGATATTAAAATACGAGGAAGATATCATTCCTTTGCTTCGTTTTCTCAGGGATAAG
ACCTTCTCCAAGCGCGGTTATTCCTGGACCGGAAAACTGCTGTCCAGCCTACTGCTGACCGTCACTCACACATAT
CCCCTCGAAAACAAATTTGTGAATCCTGCAGAATGGAACAGCCAAGGCAAGTTTGATACCTATGCAATGGCTTGT
TCATCAGTAAAACTCATTGTTTCGATATTTGCAGAATTTCGCAAGAACCACCATCGCTACTGGGGCAAGCGTTAT
GCTCAGGGCGAAGTAGAAGTATCTATACCTTTCAATCACCGAGGAATAACAATTGATATCGCGACATCCCTAGGT
CTCATGGCATGTGCCCTCAAAAGCGGCGATCGAATTCGCACTTCGGATCTTTAGGGAATTAGTCGAGCCGACTAT
GGATATTCTAGAAGCATTGATGAAATCTGGTTTGTACTCAAAATACGGATGGGAATTTGCTTATAAACATGTGGG
TACAGATGTACCACGGGATGCAAACTGGCGTAATGACTTTTGCAGGTATGTTTCCTCATTTCTCCTCCTGTTCCT
GTTTCCCCTTGACTCAAAGTTACTCAGGTATCTAACATTCGTCCGCAATGCATTTGCTGGAATACCGACCCTGTG
TGAGGAACGTATTCCTAAAGAATATTTTGAGACTTTAATATCTACGAGTGATATCCTGTGAGTGATAAATGACAC
CGTCTCAAGGCTAGACTGACTTGGGTCCCAAGAGACGAGATTCCAGAAATGATAGCCAACGTAGATCCAATCAAA
TCTGGTTTCTGTCTCACCGATCCCTCCGATCCCAAGTTCATTTTCATAACTACTCTGAGAAAGAGGTTCGGTCGA
TTCTTGCATGAGGCGTCCGTTGCCCTACGTCAACAGGGCGAGGAGAATACTGTTGATGCTGTTCAGATTTTGGTG
GGCGTACGGAGTCAATCCATATCATCAGAAAGCTAACCTTCCCAAGGTGAGATCTATGCGGACATACTTCCTTGA
ATACGCCGACAGCAGAGATAGGTATGTTGAGAGACTACGATTCGATCGGATGATATCTGAGTTATTCGCCAGCTC
TCAAGTTAACGGGGATAGTTACACCCAAGAGAAGAACATTGCACGACTCTACATTGGACAAAAGACATGGCCTCG
AGCGGTATATGTCCGAAGAGCGAGGTAAGTCGCTGGTGAACGGTTACTGATGCGACTTTTGAATTAACTTTTCAT
CACTGGAAGATTTTATTCATCCGCTCGATTGAGGTGGAATGCAATAGAGCGTTCTCGGGGACCACTCGAAGATTG
TCTGATTGACGATCTCGTGGAATGGTCAATCTGGCATTATCCCGTTATCCGACAGTACGTGGACCACTTCATCTA
TACTACGACAATTCATCTCGAACAGATCTGGTCAATCTGTATTGGAATCCATTGCAAACGTATGAATATCATATG
ATGTCCTTGTCTATTGACTAACATAAATTTAGGTCTATGATGGAGTGCGACGGCGTGCTCTTCCCGTTTTATTCA
AGGCTCTTGAACCAGGGGAAGATGATGATCGAATGAAAGGTGCCCTGTGGACCATAAATTACTCAGCATTTGGCA
AATATGCTTTGTCCGGTTGGTCCACTCGAACCCGTGCCTCTCGTCTGAGTTCAAACTTTTACAACAGAACCTAGG
CTGTCCTTGACGACGGTCAAGCACCTGTTTGGCTGCCAACACAACGAAAAGCCTTCTCTACAGAATTGTGTGTCC
GTCGTGTTTGAAAACTGTAAGTCAGCAGATTCGACCCCCGGGTGCTTATAATTTACATTCTCCAGGCCTGAATAG
TTTTTCTGAACCATGCCATGTCATCTATAATGTTGCCAAACCGAGAGTGGATCATGCCCTTGCGTACTTGAAAAC
CATTATCGTTGAAACTGAGGATGACCGAAAACTTGTGTGCCGATGTCGCGAAAAAAGGATCAGCAGAATCCAAAA
GATTGACGAAGTTTCACAACAGATTGTAGGCAGATCCGTCGTTGCCTTTTCTTTGATTGTCTAACGACACCATAG
ATAACCCATGTTCTGGATCTGTCCAACTCAGGAAAGCTGCATTGGCGGTACTCCATCTATGCCGTTCGCTGCTTG
CGCACACTTGTCCGGAGAGACATTCCTGTGCAGGCAAATCAGATGCGCTATTTTCTGACCAAGTTGCACGACAAC
CATCCCACAATTGTGAGTATGCATTTGATCCAGATAGGGCTCGTCTAGAACTTACTACTCTTTCTAGCGATATGT
AAGCCCGATGTATTACGCCAGCAGCTAAGCTCATGTACTCAACCCCATCACAGTATTCTCAGAGAGCCGTGATGA
AAAGCATCCGATCCATCAAACTTCGTACCTATTGTAAAAAACCCGCGGACCTTGCCCTTATGAATGTTTCTAATC
CATTGAAATGTTCCGTCACGGTGAAATCCTCTCGCCAAACCACGCCCGATTTCCTGAATGCCTACAAAATTCCGG
TTGACATCTCAATCCCGAGCGCTGAACCGTGAGTGAACCAAACTAATCAAAGAAGTCATACAAATGGACTCACTC
TCAAAATTTCGTAGAACATTCCATGACAAGGATCCCCCAGGTTGGCTGATTTGGAGTAGGAATGTGGATATGTAC
CGCGTTCCAGATCCGATTCGATCCACTTTTCAACCCTGGGATTCTTTGTGCGACGAAAGCATCTCAACGGTACTT
GATATCACCACCGACCAGAAATACTGGGAGAAGATATCCGTCTACTACTCCGAGGAGAACCAGGAATCTGTCATG
ATCCAGGACAACGTGTCGTGTGTCAAATCAATTTGTTTGTGGTCTCTTCATGGCTCGCGGTATCAGTGTGGCTAA
ATTTTCACAGTCCAGCTTCTCGAAGATAAACCTTTCTCTGCTTTCAAACCCGTAGTAGAGAAGTTTATCGCTGAC
AAAGACCAAAACAAGCAACGTGCCGCAGCAGAACTCCTCGCTGGGGTCCTAGGAGGTAAGGACCTAATATTTGTT
GATGTTGGAACTCTCATGCAAGGGTCCTCTAGGCTCCAAGCATTGGCCGACTCAGAAACAAAACGCCCTATGGGC
TTGGTTCATACCCCATATGAGACATATTTTCTCGCAGAACATTAAGACCGATACTTTACCCATTTGGTCTTCATT
CGTAGAGGTATGGTGTGCCTTGTCTCTCAGATTTCAGGCCTGATAAGATATCGGCTTAGTACATGCTGTACCATC
GGGATCCGCGAAGAGTTCAACCCTTGGTGGACCACATTGTCGCGTCCTTCAAAGCCCTGGATTATAACGCGGAAA
TGGCATTTGATGCTGTCAAAGTTATCACATTCTATAGATCTTTCTACGAAGAACTCGGGAGAAAATTTTTGCCAT
GGACGGACGAGGCGGTAGAACGTTCTTGGGCTGAAATATCCAGCGAACATGACGATGTTTGTGCCACTATTGTTG
ACTTGTATTGACACTAACGGGTACCTCAGGTACGCGCGTATATAGGAGACATTTTGGTTTTTTCCGAGAACATAA
AGGTCAGATTTCTCCACGTGTTTCCATTGGCGTTACCGAACCTGTCATTCAGTGGCAACCCAAGCCATCATGTCC
AGAGACGGAGGCTTTTGTAAGGGAATGTCAAATCGTTCCTGCAGATTATGACATAATGGGGATGAGAGGCACCTA
TCATAGGACAAGGGTGCTTCAGCTAGTTGATCATTTTAGGACTTGGCGTCAGGAACGTCTGCCCGGAGTGCGAGC
ATTCCAATCTACGTATGATCGGTGAGTCAGATGATGATACCTTGCTTGTTGGAATCGCTGATCGTATCATTGACT
TCTCTTCTTTCATAATTTAGAGTTGGAACAACTGTGTGCAAATGGCTCTATCTGTCCCTTCATGATCTTCATGCC
ATTTCGGCTTTCGATTATATACTCCCTCTGATGGTGCGAATATTGCTTTTGACTACCTTTCAATTGATTAAACTG
CCGCACAGTCCGAAATCTTCCGATTCACAGAACGTGAGCTCCCTTTCTTTCAGGCTTCCGATCTTTCGAATCTGA
TGATTCGTAGTCAATGACAATGATGACCTTGCCACAAGGGCAAGTCGGCTCCTAGTGCGGATGTGTGGCGTAACC
CCTCCTGTGCCACTAGTTAATCCTATATTGGATGCGATCTTCCACACGATTCAGAATTCGCCTGTGAGTGTCTCG
AGTTCGTCCGTTAGCTTGGTTCTGAGTCGGAGAAAAGTCTTGGAAGGTTCGGCTTAAGGCTCTACCGCTGGTCCA
AGGTGAGTCGTCGTTTCTGATTTCTACGGCCTGCTTTCCTTTGGTGGGTACAGTAAGGGAAAAAAATAGCCATAC
GCCGGGTTCATTTCCTTACTACCCTTTTTACCTTATTCATTTTCCATATTTTTCTTTTGAGTGGTGAACGATTGC
TGATTTTATGCAGTGTTCTATTTCCGACAGCTTCCGTTGATTCCGGAAATCAAAATCGTTGAAATGCTTGAAGTA
AGTAAGAAACGCAGCCTGTATCACTTAAAGACATGGGACATAGAGCGTATTGCGTTGTGCAGTGAAAATTTTAAT
GCTGATCTTACGTTCTTCAGGTCCTCTGCCGATGTCTTGATGATGAAGTGGTGGAAGTGCGGGAGATGGCAGCCG
TGTAAGTTTCTAAGTTTCTTGCCATGCGCTCTCTCCCTTTCCTCCCTGTTTACTCCACACACATCTCCACCGATA
TCATGCTTCCAAATTTATTTGCTCGCCTCATTTACTCACCAATTCTATTAATCTTCGACCACTTCTCACTAATGA
CGTCCTAAATATATATTGGACATTTTCATGGCTCACGTCGTATTTATAGCACACTCTCTGGGATTCTACGTTTAT
CGCCGCGGCGCAGTATTCTGACACTCAAAGTAAGGCTCAAATTCTTTGATTGCTTTGCAAGTTCTCATCGATAGC
ATTTTAGGATCGATTCGTGAGGTTGTTGAAGAACAGTCACATCCCCAGTCGAAATGATGCAAACTATAATAAAGC
GATACGCCAGAGGCACGCAGCCATATTAGGAATCTGCGCACTGGTGGAAAGTTATCCTTATACGGTCGAGAAGTG
GTTGCCCGAATTGCTTACGGGTGTGTTGGCGGAGCACACATATGATCCAGTGAGTCTATGAATATTCATCAGTTC
ATTTCACTACGGTGGCTTAATGAGTTGATAGATCCCGATTTCGACAACAGTGCGCAATTGTGCCAGTAACTTCAA
AAGAACGCATCAAGATACCTGGCACGAAGATTGTAAACGTTTCAATGAGGACCAGCTCGCATCATTATCTACTTT
GCTATCCGGCTCGTCGTATTGTCGGTTACATTCATCTGTTCGAAAATTTGCTCGCTGACCATCGCGCATATAGAT
GCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail