Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011140
Gene name
Locationscaffold_1:2631940..2633975
Strand+
Gene length (bp)2035
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.9E-07 181 221
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.9E-06 181 221
PF13445 zf-RING_UBOX RING-type zinc-finger 8.8E-07 181 219
PF13639 zf-RING_2 Ring finger domain 3.1E-06 181 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 178 243 4.0E-08
sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 178 243 4.0E-08
sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 178 243 4.0E-08
sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 178 243 4.0E-08
sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 178 243 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 178 243 4.0E-08
sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 178 243 4.0E-08
sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 178 243 4.0E-08
sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 178 243 4.0E-08
sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 178 243 5.0E-08
sp|Q66J69|RNG2A_XENLA E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis GN=rnf2-a PE=2 SV=1 178 243 1.0E-07
sp|Q7ZWM8|RNG2B_XENLA E3 ubiquitin-protein ligase RING2-B OS=Xenopus laevis GN=rnf2-b PE=2 SV=2 178 243 1.0E-07
sp|A2T6X5|RING1_PANTR E3 ubiquitin-protein ligase RING1 OS=Pan troglodytes GN=RING1 PE=3 SV=1 178 243 1.0E-07
sp|A1YFY1|RING1_PANPA E3 ubiquitin-protein ligase RING1 OS=Pan paniscus GN=RING1 PE=3 SV=1 178 243 1.0E-07
sp|Q8WMN5|RING1_MACMU E3 ubiquitin-protein ligase RING1 OS=Macaca mulatta GN=RING1 PE=3 SV=1 178 243 1.0E-07
sp|A1YER5|RING1_GORGO E3 ubiquitin-protein ligase RING1 OS=Gorilla gorilla gorilla GN=RING1 PE=3 SV=1 178 243 1.0E-07
sp|O35730|RING1_MOUSE E3 ubiquitin-protein ligase RING1 OS=Mus musculus GN=Ring1 PE=1 SV=2 178 243 1.0E-07
sp|Q06587|RING1_HUMAN E3 ubiquitin-protein ligase RING1 OS=Homo sapiens GN=RING1 PE=1 SV=2 178 243 1.0E-07
sp|Q5TJF3|RING1_CANLF E3 ubiquitin-protein ligase RING1 OS=Canis lupus familiaris GN=RING1 PE=3 SV=2 178 243 2.0E-07
sp|Q6MGB6|RING1_RAT E3 ubiquitin-protein ligase RING1 OS=Rattus norvegicus GN=Ring1 PE=2 SV=2 178 243 2.0E-07
sp|Q9VB08|RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster GN=Sce PE=1 SV=1 178 243 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011140
MSEDEFDNLPDLFSGVTDAEWSRMLDAPGESSSIRHPHGVSPSRSTVSTDYGDEHFVNPEALAEIDRIETSLSSF
GSTASARRVGEVISTASGHTTHHQDSLRPPTNDSSQSRYLPNADHCHAHTLVRTSVACLTEAPEKQATGKRSRLE
DAESTVVKNGIVRAYDKIQYALDGYGEELCCPICCDLFVATHLGNPCGHSYCGDCAWQWVNKNDRTECPICRTQL
VGEAPLIPNITLDSLIEKHIELLISAGDIDWLPQGSKYKDRASRKAKWKASVDARSKALKTKRKRKEVVFISSDD
EDPYIEHSSQETGQADTEMNSLHVRLGYLYREGIDNALTFGIGSLPCIWSMSTSYQLTDFTKKSHTMSKMNFGAG
CYVCDRLSSFKHESCVSVQIPEDVYCCK*
Coding >AgabiH97|011140
ATGTCTGAAGACGAATTCGATAATCTTCCAGATCTATTTTCCGGTGTCACTGATGCTGAGTGGTCAAGAATGCTG
GATGCTCCGGGAGAATCTTCTTCAATCCGACACCCTCATGGCGTCAGTCCCTCGAGGTCAACCGTATCGACGGAT
TATGGAGATGAGCACTTCGTGAATCCGGAAGCTCTAGCCGAAATTGATCGTATAGAAACGTCCTTATCAAGTTTT
GGCAGTACGGCATCTGCAAGGCGTGTTGGAGAAGTGATTTCAACGGCAAGTGGGCACACCACACACCATCAAGAC
TCATTGAGACCTCCGACCAATGATTCGTCGCAATCGCGTTATCTTCCGAATGCAGATCACTGCCATGCACATACG
CTGGTACGAACTTCTGTCGCATGTCTGACTGAAGCCCCGGAAAAACAAGCAACCGGAAAAAGGTCACGACTTGAA
GACGCCGAGAGTACAGTAGTCAAGAATGGAATAGTGCGAGCTTATGACAAGATTCAATATGCTCTTGATGGTTAC
GGAGAGGAATTATGTTGTCCTATTTGTTGTGACTTGTTCGTGGCCACTCACCTTGGGAATCCATGTGGCCACAGC
TATTGTGGCGATTGTGCGTGGCAGTGGGTCAACAAAAATGACCGTACTGAGTGTCCCATTTGCCGGACTCAGCTA
GTAGGAGAAGCACCGCTTATTCCAAATATAACTTTGGATAGCCTTATCGAAAAGCATATCGAGCTTCTCATTTCG
GCAGGAGACATTGACTGGCTGCCTCAAGGTTCTAAATATAAAGACCGGGCTTCCCGAAAAGCGAAATGGAAAGCC
TCCGTTGACGCTAGGTCGAAGGCCCTGAAAACGAAGCGAAAACGAAAGGAGGTTGTTTTTATTTCAAGTGATGAT
GAAGATCCATACATTGAGCATTCATCCCAGGAAACTGGACAGGCAGATACGGAGATGAATTCGCTGCATGTTCGT
CTTGGATATTTATATCGGGAGGGTATTGACAACGCCCTCACTTTTGGAATTGGATCCTTGCCCTGCATTTGGAGC
ATGTCCACCTCTTATCAGCTAACAGATTTTACTAAAAAAAGTCACACGATGTCCAAAATGAATTTTGGGGCAGGA
TGTTATGTATGCGATCGACTATCAAGCTTCAAACATGAATCATGTGTATCCGTCCAGATACCTGAGGATGTTTAT
TGCTGCAAATAG
Transcript >AgabiH97|011140
ATGTCTGAAGACGAATTCGATAATCTTCCAGATCTATTTTCCGGTGTCACTGATGCTGAGTGGTCAAGAATGCTG
GATGCTCCGGGAGAATCTTCTTCAATCCGACACCCTCATGGCGTCAGTCCCTCGAGGTCAACCGTATCGACGGAT
TATGGAGATGAGCACTTCGTGAATCCGGAAGCTCTAGCCGAAATTGATCGTATAGAAACGTCCTTATCAAGTTTT
GGCAGTACGGCATCTGCAAGGCGTGTTGGAGAAGTGATTTCAACGGCAAGTGGGCACACCACACACCATCAAGAC
TCATTGAGACCTCCGACCAATGATTCGTCGCAATCGCGTTATCTTCCGAATGCAGATCACTGCCATGCACATACG
CTGGTACGAACTTCTGTCGCATGTCTGACTGAAGCCCCGGAAAAACAAGCAACCGGAAAAAGGTCACGACTTGAA
GACGCCGAGAGTACAGTAGTCAAGAATGGAATAGTGCGAGCTTATGACAAGATTCAATATGCTCTTGATGGTTAC
GGAGAGGAATTATGTTGTCCTATTTGTTGTGACTTGTTCGTGGCCACTCACCTTGGGAATCCATGTGGCCACAGC
TATTGTGGCGATTGTGCGTGGCAGTGGGTCAACAAAAATGACCGTACTGAGTGTCCCATTTGCCGGACTCAGCTA
GTAGGAGAAGCACCGCTTATTCCAAATATAACTTTGGATAGCCTTATCGAAAAGCATATCGAGCTTCTCATTTCG
GCAGGAGACATTGACTGGCTGCCTCAAGGTTCTAAATATAAAGACCGGGCTTCCCGAAAAGCGAAATGGAAAGCC
TCCGTTGACGCTAGGTCGAAGGCCCTGAAAACGAAGCGAAAACGAAAGGAGGTTGTTTTTATTTCAAGTGATGAT
GAAGATCCATACATTGAGCATTCATCCCAGGAAACTGGACAGGCAGATACGGAGATGAATTCGCTGCATGTTCGT
CTTGGATATTTATATCGGGAGGGTATTGACAACGCCCTCACTTTTGGAATTGGATCCTTGCCCTGCATTTGGAGC
ATGTCCACCTCTTATCAGCTAACAGATTTTACTAAAAAAAGTCACACGATGTCCAAAATGAATTTTGGGGCAGGA
TGTTATGTATGCGATCGACTATCAAGCTTCAAACATGAATCATGTGTATCCGTCCAGATACCTGAGGATGTTTAT
TGCTGCAAATAG
Gene >AgabiH97|011140
ATGTCTGAAGACGAATTCGATAATCTTCCAGATCTATTTTCCGGTGTCACTGATGCTGAGTGGTCAAGAATGCTG
GATGCTCCGGGAGAATCTTCTTCAATCCGACACCCTCATGGCGTCAGTCCCTCGAGGTCAACCGTATCGACGGAT
TATGGAGATGAGCACTTCGTGAATCCGGAAGCTCTAGCCGAAATTGATCGTATAGAAACGTCCTTATCAAGTTTT
GGCAGTACGGCATCTGCAAGGCGTGTTGGAGGTTGGTTTTCCACACCTCCACTCTCTATGGTATCTTAATGAACA
TAGAAGTGATTTCAACGGCAAGTGGGCACACCACACACCATCAAGACTCATTGAGTAAGTTGACAAATTTTGATA
CCTGTTTCGGTTTTTCACATGTGAAGTTAGGACGTAAATCCACCGCTCTTTACGCATGCATTAATAGTGAAGGTG
GCAATTAGCTCCGACCAATGATTCGTCGCAATCGCGTTATCTTCCGAATGCAGATCACTGCCATGCACATACGCT
GGTACGAACTTCTGTCGCATGTCTGACTGAAGCCCCGGAAAAACAAGGTAAGCCAGGCGGTTATATTTGGTTCCG
CGGTAAGATGTTAACCAAGCCTTCGTCAGCAACCGGAAAAAGGTCACGACTTGAAGACGCCGAGAGTACAGTAGT
CAAGAATGGAATAGTGCGAGCTTATGACAAGATTCAATATGCTCTTGATGGTTACGGAGAGGAATTATGTTGTCC
TATGTGAGTAATCAGTGGCCACTTGCACACCGAAATGATAGTTCTGACAATGTGCGGCTAAGTTGTTGTGACTTG
TTGTAAGTCAATCATTCGGTCTCCGTAGAGCCAGGTTTAATGGATGGATATGAAGCGTGGCCACTCACCTTGGGA
ATCCATGTGGCCACAGCTATTGTGGCGATTGTGCGTGGCAGTGGGTCAACAAAAATGTTTGTACCATCATTAGAC
ACGTGCTGTGATTATGCTCACTCGCATCAGGACCGTACTGAGTGTCCCATTTGCCGGACTCAGCTAGTAGGAGAA
GCACCGCTTATTCCAAATATAACTTTGGATAGCCTTATCGAAAAGCATATCGAGCTTCTCATTTCGGCAGGAGAC
ATTGACTGGCTGCCTCAAGGTTCTAAATATAAAGACCGGGCTTCCCGAAAAGCGTAAGCCTTTCATGTGAAGTAT
TAGTTGAAAGTAAGCTCACGCGGGGACGTTCGTTTGTTCGCCTAGGAAATGGAAAGCCTCCGTTGACGCTAGGTC
GAAGGCCCTGAAAACGAAGCGAAAACGAAAGGTGAATGTGTTTCCGTAATGATCGACGTGATCTTTCTGAATCAT
TTGTAGGAGGTTGTTTTTATTTCAAGTGATGATGAAGATCCATACATTGAGCATTCATCCCAGGAAACTGGACAG
GTTGGAATGGTCAGAGCTCGTTCCAATCGTCGACGCCGAAATTCGAGGCAGATACGGAGATGAATTCGCTGCATG
TTCGTCTTGGATATTTATATCGGGAGGGTATTGACAACGCCCTCACGTACGTCAACACCGTCTCGTGTTTATCAA
ACGGGTCCAATTGGTAACCGCAACGCCACAGTTTTGGAATTGGATCCTTGCCCTGCATTTGGAGCATGTCCACCT
CTTATCGTGAGATCATCTATGCTTCTACTACTTGTCTAGGAAGCGTCTGACAGACACTCTGGATGTCCCTGCAAT
CAATCACCCATCTGACTTCCAAGAGCTAACAGATTTTACTAAAAAAAGTCACACGATGTCCAAAATGAATGTGAA
GGCTTCTGTCGAATGAAACTGAGCTTCAGTAGAGGGGGCCACTCGGGGGCACAGTGGCTGATTTACGTGACGGTC
AAATCATAGTTTGGGGCAGGATGTTATGTATGCGATCGACTATCAAGCTTCAAACATGAATCATGTATTTCGTTC
TTGGAATCATATCCTTCAGTGGCTAACGAGCGGCGTTGCAGGTGTATCCGTCCAGATACCTGAGGATGTTTATTG
CTGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail