Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|011100
Gene name
Locationscaffold_1:2620689..2622621
Strand+
Gene length (bp)1932
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 6.0E-21 30 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 5 341 9.0E-86
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 5 322 5.0E-85
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 29 322 6.0E-78
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 5 326 2.0E-72
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 28 328 5.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 5 341 9.0E-86
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 5 322 5.0E-85
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 29 322 6.0E-78
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 5 326 2.0E-72
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 28 328 5.0E-63
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT3 PE=1 SV=2 9 315 7.0E-63
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 28 326 1.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 28 315 2.0E-51
sp|Q5AAH2|CHI1_CANAL Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT1 PE=1 SV=1 29 330 4.0E-50
sp|P46876|CHI1_CANAX Chitinase 1 OS=Candida albicans GN=CHT1 PE=3 SV=2 29 330 8.0E-50
sp|P29060|CHIA_TOBAC Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1 29 323 1.0E-47
sp|E9ENC6|CHI3_METRA Endochitinase 3 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi3 PE=3 SV=1 11 326 1.0E-47
sp|P51614|CHIT3_VITVI Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1 30 307 7.0E-47
sp|P36910|CHIE_BETVU Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1 10 326 2.0E-46
sp|P36908|CHIA_CICAR Acidic endochitinase OS=Cicer arietinum PE=2 SV=1 30 323 2.0E-46
sp|P19172|CHIA_ARATH Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2 1 307 3.0E-46
sp|Q6QDR4|CHI3_METAN Endochitinase 3 (Fragment) OS=Metarhizium anisopliae GN=chi3 PE=1 SV=1 30 317 2.0E-45
sp|P23472|CHLY_HEVBR Hevamine-A OS=Hevea brasiliensis PE=1 SV=2 30 322 4.0E-44
sp|P29024|CHIA_PHAAN Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1 22 308 8.0E-44
sp|P29061|CHIB_TOBAC Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1 29 308 2.0E-43
sp|Q873Y0|CHIA1_ASPFM Endochitinase A1 OS=Neosartorya fumigata GN=chiA1 PE=1 SV=1 2 321 1.0E-40
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 2 317 7.0E-40
sp|Q4WEP7|CHIA1_ASPFU Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiA1 PE=3 SV=1 2 321 7.0E-40
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 4 317 7.0E-40
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 32 329 1.0E-39
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 32 315 3.0E-39
sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 18 326 3.0E-37
sp|Q9C105|YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.04c PE=3 SV=1 3 312 5.0E-35
sp|D4AT07|CHI1_ARTBC Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07371 PE=3 SV=1 12 316 6.0E-35
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 18 319 9.0E-34
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 18 319 9.0E-34
sp|A2QUQ2|CHIA1_ASPNC Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ctcA PE=2 SV=1 16 316 9.0E-31
sp|P49347|CONB_CANEN Concanavalin B OS=Canavalia ensiformis PE=1 SV=1 7 328 2.0E-23
sp|Q53NL5|XIP2_ORYSJ Xylanase inhibitor protein 2 OS=Oryza sativa subsp. japonica GN=Chib3H-h PE=1 SV=1 105 308 3.0E-18
sp|Q8L5C6|XIP1_WHEAT Xylanase inhibitor protein 1 OS=Triticum aestivum GN=XIPI PE=1 SV=2 29 308 2.0E-17
sp|Q7GCM7|XIP1_ORYSJ Xylanase inhibitor protein 1 OS=Oryza sativa subsp. japonica GN=RIXI PE=1 SV=1 103 308 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 48.49 26.31 70.66
Initials Initials knots 25.65 14.03 37.27
Pileal_Stipeal_center Stage I stipe center 17.16 8.80 25.53
Pileal_Stipeal_shell Stage I stipe shell 21.40 11.43 31.36
DIF_stipe_center Stage II stipe center 17.56 9.14 25.97
DIF_stipe_shell Stage II stipe shell 18.33 9.59 27.08
DIF_stipe_skin Stage II stipe skin 16.46 8.47 24.44
DIF_cap_skin Stage II cap skin 21.77 11.64 31.90
DIF_cap_tissue Stage II cap tissue 22.50 12.08 32.93
DIF_gill_tissue Stage II gill tissue 22.22 11.94 32.50
YFB_stipe_center Young fruiting body stipe center 18.15 9.46 26.84
YFB_stipe_shell Young fruiting body stipe shell 19.65 10.38 28.93
YFB_stipe_skin Young fruiting body stipe skin 15.55 7.94 23.16
YFB_cap_skin Young fruiting body cap skin 21.58 11.44 31.72
YFB_cap_tissue Young fruiting body cap tissue 26.37 14.44 38.29
YFB_gill_tissue Young fruiting body gill tissue 18.57 9.72 27.41
YFB_veil Young fruiting body veil 18.21 9.36 27.07

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.008457 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.001625 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.008121 yes
Casing YFB_cap_tissue 0.041603 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.032038 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.004160 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.006032 yes
Casing DIF_cap_tissue 0.007092 yes
DIF_gill_tissue YFB_stipe_center 0.656795 no
DIF_gill_tissue YFB_stipe_shell 0.814516 no
DIF_gill_tissue YFB_stipe_skin 0.331689 no
DIF_gill_tissue YFB_cap_skin 0.963005 no
DIF_gill_tissue YFB_cap_tissue 0.708361 no
DIF_gill_tissue YFB_gill_tissue 0.702975 no
DIF_gill_tissue YFB_veil 0.668205 no
YFB_stipe_center YFB_stipe_shell 0.893980 no
YFB_stipe_center YFB_stipe_skin 0.764897 no
YFB_stipe_center YFB_cap_skin 0.723137 no
YFB_stipe_center YFB_cap_tissue 0.288884 no
YFB_stipe_center YFB_gill_tissue 0.971872 no
YFB_stipe_center YFB_veil 0.995105 no
YFB_stipe_shell YFB_stipe_skin 0.598657 no
YFB_stipe_shell YFB_cap_skin 0.868601 no
YFB_stipe_shell YFB_cap_tissue 0.446922 no
YFB_stipe_shell YFB_gill_tissue 0.925650 no
YFB_stipe_shell YFB_veil 0.898618 no
YFB_stipe_skin YFB_cap_skin 0.404441 no
YFB_stipe_skin YFB_cap_tissue 0.095802 no
YFB_stipe_skin YFB_gill_tissue 0.718645 no
YFB_stipe_skin YFB_veil 0.761906 no
YFB_cap_skin YFB_cap_tissue 0.654906 no
YFB_cap_skin YFB_gill_tissue 0.771336 no
YFB_cap_skin YFB_veil 0.737599 no
YFB_cap_tissue YFB_gill_tissue 0.335330 no
YFB_cap_tissue YFB_veil 0.313067 no
YFB_gill_tissue YFB_veil 0.977123 no
Initials DIF_gill_tissue 0.768246 no
Initials YFB_stipe_center 0.344928 no
Initials YFB_stipe_shell 0.505049 no
Initials YFB_stipe_skin 0.124851 no
Initials YFB_cap_skin 0.712595 no
Initials YFB_cap_tissue 0.963094 no
Initials YFB_gill_tissue 0.385534 no
Initials YFB_veil 0.360449 no
Initials Pileal_Stipeal_center 0.255688 no
Initials Pileal_Stipeal_shell 0.685822 no
Initials DIF_stipe_center 0.283761 no
Initials DIF_stipe_shell 0.358752 no
Initials DIF_stipe_skin 0.196285 no
Initials DIF_cap_skin 0.720198 no
Initials DIF_cap_tissue 0.790385 no
Pileal_Stipeal_center DIF_gill_tissue 0.543011 no
Pileal_Stipeal_center YFB_stipe_center 0.930116 no
Pileal_Stipeal_center YFB_stipe_shell 0.800638 no
Pileal_Stipeal_center YFB_stipe_skin 0.869220 no
Pileal_Stipeal_center YFB_cap_skin 0.615400 no
Pileal_Stipeal_center YFB_cap_tissue 0.217538 no
Pileal_Stipeal_center YFB_gill_tissue 0.895480 no
Pileal_Stipeal_center YFB_veil 0.926731 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.619743 no
Pileal_Stipeal_center DIF_stipe_center 0.972299 no
Pileal_Stipeal_center DIF_stipe_shell 0.915332 no
Pileal_Stipeal_center DIF_stipe_skin 0.947766 no
Pileal_Stipeal_center DIF_cap_skin 0.581813 no
Pileal_Stipeal_center DIF_cap_tissue 0.515243 no
Pileal_Stipeal_shell DIF_gill_tissue 0.952144 no
Pileal_Stipeal_shell YFB_stipe_center 0.734491 no
Pileal_Stipeal_shell YFB_stipe_shell 0.883025 no
Pileal_Stipeal_shell YFB_stipe_skin 0.408200 no
Pileal_Stipeal_shell YFB_cap_skin 0.988995 no
Pileal_Stipeal_shell YFB_cap_tissue 0.622063 no
Pileal_Stipeal_shell YFB_gill_tissue 0.779887 no
Pileal_Stipeal_shell YFB_veil 0.744649 no
Pileal_Stipeal_shell DIF_stipe_center 0.660594 no
Pileal_Stipeal_shell DIF_stipe_shell 0.753266 no
Pileal_Stipeal_shell DIF_stipe_skin 0.531968 no
Pileal_Stipeal_shell DIF_cap_skin 0.977974 no
Pileal_Stipeal_shell DIF_cap_tissue 0.934174 no
DIF_stipe_center DIF_gill_tissue 0.578865 no
DIF_stipe_center YFB_stipe_center 0.959045 no
DIF_stipe_center YFB_stipe_shell 0.835337 no
DIF_stipe_center YFB_stipe_skin 0.825568 no
DIF_stipe_center YFB_cap_skin 0.651099 no
DIF_stipe_center YFB_cap_tissue 0.232204 no
DIF_stipe_center YFB_gill_tissue 0.927453 no
DIF_stipe_center YFB_veil 0.955917 no
DIF_stipe_center DIF_stipe_shell 0.945874 no
DIF_stipe_center DIF_stipe_skin 0.914994 no
DIF_stipe_center DIF_cap_skin 0.617730 no
DIF_stipe_center DIF_cap_tissue 0.549789 no
DIF_stipe_shell DIF_gill_tissue 0.673436 no
DIF_stipe_shell YFB_stipe_center 0.987667 no
DIF_stipe_shell YFB_stipe_shell 0.908091 no
DIF_stipe_shell YFB_stipe_skin 0.744568 no
DIF_stipe_shell YFB_cap_skin 0.742178 no
DIF_stipe_shell YFB_cap_tissue 0.299743 no
DIF_stipe_shell YFB_gill_tissue 0.984345 no
DIF_stipe_shell YFB_veil 0.991577 no
DIF_stipe_shell DIF_stipe_skin 0.847524 no
DIF_stipe_shell DIF_cap_skin 0.714430 no
DIF_stipe_shell DIF_cap_tissue 0.645120 no
DIF_stipe_skin DIF_gill_tissue 0.452407 no
DIF_stipe_skin YFB_stipe_center 0.868132 no
DIF_stipe_skin YFB_stipe_shell 0.717312 no
DIF_stipe_skin YFB_stipe_skin 0.929909 no
DIF_stipe_skin YFB_cap_skin 0.524765 no
DIF_stipe_skin YFB_cap_tissue 0.154913 no
DIF_stipe_skin YFB_gill_tissue 0.828555 no
DIF_stipe_skin YFB_veil 0.864903 no
DIF_stipe_skin DIF_cap_skin 0.491153 no
DIF_stipe_skin DIF_cap_tissue 0.428302 no
DIF_cap_skin DIF_gill_tissue 0.972398 no
DIF_cap_skin YFB_stipe_center 0.698535 no
DIF_cap_skin YFB_stipe_shell 0.850094 no
DIF_cap_skin YFB_stipe_skin 0.379525 no
DIF_cap_skin YFB_cap_skin 0.988080 no
DIF_cap_skin YFB_cap_tissue 0.661626 no
DIF_cap_skin YFB_gill_tissue 0.743856 no
DIF_cap_skin YFB_veil 0.708695 no
DIF_cap_skin DIF_cap_tissue 0.954865 no
DIF_cap_tissue DIF_gill_tissue 0.983990 no
DIF_cap_tissue YFB_stipe_center 0.634833 no
DIF_cap_tissue YFB_stipe_shell 0.791551 no
DIF_cap_tissue YFB_stipe_skin 0.320555 no
DIF_cap_tissue YFB_cap_skin 0.947002 no
DIF_cap_tissue YFB_cap_tissue 0.737870 no
DIF_cap_tissue YFB_gill_tissue 0.680633 no
DIF_cap_tissue YFB_veil 0.644063 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|011100
MMLNIARTFIVLAFSTWLADAFDNSRFDNLAVYWGQNSYGAGHSDTANWQKPVSFYCNDDAINVFPVAFLHVFFG
PGGLPSINLANTCNDKDNSVFPGTDLPNCSALAADIKACQAKGKILTLSLGGATGSVGFQSDGQAETFAETIWNL
FLGGSSSTRPFGSASLDGIDLDIEGGSSAHYAAFVNKIRSLASGASKKYYVTAAPQCVYPDSALGGVLNSAHFDA
IYGKFYNNPCGLQNFNSVSNWNFGIWDNWARTISPNKDVKVYIGAPASSSAAGGGYVDSTTLRNIANKMRRSFPS
FGGVMLWDASQAYANNRYDQAIKNGLTSAGGTGFTFPPCSAPTYSAGEVYVGGLQASFGGYIWQSKWWTNSQPAH
NPFGDWSAISACR*
Coding >AgabiH97|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACTTGGCAGTATATTGGGGCCAGAATTCCTACGGGGCCGGTCATAGTGATACAGCAAACTGGCAG
AAGCCGGTATCCTTCTATTGCAATGATGATGCGATAAACGTCTTCCCTGTAGCTTTCCTACATGTCTTTTTTGGG
CCCGGCGGCCTTCCTTCCATCAACTTGGCCAATACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGAT
CTGCCGAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTA
GGCGGTGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTG
TTCTTGGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGTATTGACTTGGACATTGAGGGT
GGATCATCGGCCCATTATGCTGCTTTCGTCAACAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTATTAC
GTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATTCCGCGCATTTCGATGCT
ATCTATGGTAAATTTTACAATAACCCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGAATTGGAACTTTGGTATT
TGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTGCTTCCAGTTCA
GCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAAGTTTCCCATCT
TTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGCAAATAACCGGTATGATCAAGCAATTAAGAATGGC
TTGACTTCCGCAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTAC
GTAGGTGGCCTGCAGGCCTCCTTTGGAGGGTACATCTGGCAGTCAAAATGGTGGACAAACTCCCAACCAGCACAT
AATCCATTCGGCGACTGGAGCGCGATCAGCGCCTGTCGATAA
Transcript >AgabiH97|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACTTGGCAGTATATTGGGGCCAGAATTCCTACGGGGCCGGTCATAGTGATACAGCAAACTGGCAG
AAGCCGGTATCCTTCTATTGCAATGATGATGCGATAAACGTCTTCCCTGTAGCTTTCCTACATGTCTTTTTTGGG
CCCGGCGGCCTTCCTTCCATCAACTTGGCCAATACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGAT
CTGCCGAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTA
GGCGGTGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTG
TTCTTGGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGTATTGACTTGGACATTGAGGGT
GGATCATCGGCCCATTATGCTGCTTTCGTCAACAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTATTAC
GTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATTCCGCGCATTTCGATGCT
ATCTATGGTAAATTTTACAATAACCCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGAATTGGAACTTTGGTATT
TGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTGCTTCCAGTTCA
GCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAAGTTTCCCATCT
TTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGCAAATAACCGGTATGATCAAGCAATTAAGAATGGC
TTGACTTCCGCAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTAC
GTAGGTGGCCTGCAGGCCTCCTTTGGAGGGTACATCTGGCAGTCAAAATGGTGGACAAACTCCCAACCAGCACAT
AATCCATTCGGCGACTGGAGCGCGATCAGCGCCTGTCGATAA
Gene >AgabiH97|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACGTATATTTTCCCGTCAATTCTTCATTTCTCAGCTGACGCGAAGACGTTGTTCACAGTTGGCAG
TGTAAGTTCTTTAATCGAATGGTCATACTCAAGCATCTAACTGGGGTCAATCCAGATATTGGGGCCAGAATTCCT
ACGGGGCCGGTCATAGTGATACAGCAAACTGGCAGAAGCCGGTATCCTTCTATTGCAATGCAAGTCATTTTTGAT
GGTATCATCTCATTTTCTGACAATGACCCAAACGTTACTTAGGATGATGCGATAAACGTCTTCCCTGTAGCTTTC
CTACATGTCTTTTTTGGGCCCGGCGGCCTTCCTTCCATCAACTTGGCCAATGTAGGTCGATCTCAAACCCAGCAT
TGATCAAGCAATTTGACGTTTCGCCCAGACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGATCTGCC
GAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTAGGCGG
TGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTGTTCTT
GGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGGTAAGCCGTTGCTTAAGCCGCTTCTAA
TCTGAGCTTATCCAATGCTAGTATTGACTTGGACATTGAGGGTGGATCATCGGCCCATTATGCTGCTTTCGTCAA
CAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTGAGATTTTCTTTCCCAGCATAGCTTGTCGTTCAACGA
TAGCACACAGGTATTACGTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATT
CCGCGCATTTCGATGCTATCTATGGTAAGTATTTTTAACGCCTACTCCACGAACTTTCTTTTCTGACAACTTCTG
AAGTTCAGTCAGTGTTAACCATCTTCCTCACTTTTTGTCCAGAACATAACGCCTTGTCACAGATTTTACAATAAC
CCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGGTTAGTCTGTTCAACGTCAACATCGACTCCATCTGAAGCTAA
ACTTTAAAAACTATAGAATTGGAACTTTGGTATTTGGTAAGGGAATTCCCCTCCCATGTGAGGCATAAAATGACA
AGTGGGAATCAAGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTG
CTTCCAGTTCAGCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAA
GTTTCCCATCTTTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGGTAACTTTCCCTTCGATTCCTATT
GATGATAGCCTTGTTCAAGGGATTATTTAGCAAATAACCGGTATGATCAAGCAATTAAGAATGGCTTGACTTCCG
CAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTACGTAGGTGGCC
TGCAGGCCTCCTTTGGAGGGTGAGTTTTGATTCCACAAAACTACAGGTTGAATGCCGAACTCATCTGAACTCGCT
TAGGTACATCTGGCAGGTAAATAATTACTCTCGCGATACTCTCTGAAAAAGGTCACTCACAGTAACTTAGTCAAA
ATGGTGGACAAACTCCCAACCAGCACATAATCCATTCGGCGACTGGAGCGCGAGTATGTGTTATGTTTTTATTCG
TGCTCTTACCAAATTTATCACTGATGAACCTTTTTTCCAGTCAGCGCCTGTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail