Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010920
Gene name
Locationscaffold_1:2582318..2583008
Strand-
Gene length (bp)690
Transcript length (bp)507
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010920
MTIAEFRTLPGSALILSILTSLSLRSLVGSKEFARQVSSSCQVNNYGYWTMLVSQTHERERRVRVNKKLNQDMKE
IYSPKECLLACPVSDGFGSPGISLARLTLRFIERTTSAPRMSCHELEQIGLFCRSVCAQSETIHSKQGKIGPFPL
TDVANERIVPSAGRISGD*
Coding >AgabiH97|010920
ATGACTATAGCGGAGTTTAGAACACTCCCTGGCAGCGCGCTTATACTAAGTATACTGACCAGCTTATCGCTGCGT
TCTTTGGTCGGTTCTAAAGAATTCGCGAGGCAAGTATCCTCGAGTTGTCAGGTCAACAACTACGGCTACTGGACC
ATGCTTGTGTCTCAGACTCACGAGAGGGAAAGAAGAGTTCGAGTAAACAAGAAACTCAACCAGGATATGAAAGAA
ATATACTCACCAAAGGAATGCCTTCTCGCTTGTCCCGTTTCTGATGGATTTGGATCCCCTGGCATCAGTCTGGCT
AGACTAACACTCAGGTTCATCGAGCGAACGACCTCAGCACCCCGGATGAGCTGTCACGAACTGGAGCAGATTGGC
CTATTCTGTAGGAGCGTCTGTGCGCAGTCTGAGACTATACATTCGAAACAGGGGAAGATAGGACCTTTTCCCTTA
ACAGATGTCGCTAACGAAAGGATCGTTCCCAGTGCCGGGAGGATAAGTGGAGACTAA
Transcript >AgabiH97|010920
ATGACTATAGCGGAGTTTAGAACACTCCCTGGCAGCGCGCTTATACTAAGTATACTGACCAGCTTATCGCTGCGT
TCTTTGGTCGGTTCTAAAGAATTCGCGAGGCAAGTATCCTCGAGTTGTCAGGTCAACAACTACGGCTACTGGACC
ATGCTTGTGTCTCAGACTCACGAGAGGGAAAGAAGAGTTCGAGTAAACAAGAAACTCAACCAGGATATGAAAGAA
ATATACTCACCAAAGGAATGCCTTCTCGCTTGTCCCGTTTCTGATGGATTTGGATCCCCTGGCATCAGTCTGGCT
AGACTAACACTCAGGTTCATCGAGCGAACGACCTCAGCACCCCGGATGAGCTGTCACGAACTGGAGCAGATTGGC
CTATTCTGTAGGAGCGTCTGTGCGCAGTCTGAGACTATACATTCGAAACAGGGGAAGATAGGACCTTTTCCCTTA
ACAGATGTCGCTAACGAAAGGATCGTTCCCAGTGCCGGGAGGATAAGTGGAGACTAA
Gene >AgabiH97|010920
ATGACTATAGCGGAGTTTAGAACACTCCCTGGCAGCGCGCTTATACTAAGTATACTGACCAGCTTATCGCTGCGT
TCTTTGGTCGGTTCTAAAGGTATCATACTGCCATCAAATACGTCTACCAGGAATCCGCTGAGGTTCTCCTATGGA
CAGAATTCGCGAGGCAAGTATCCTCGAGTTGTCAGGTCAACAACTACGGCTACTGGACCATGCTTGTGTCTCAGA
CTCACGAGAGGGAAAGAAGAGTTCGAGTAAACAAGAAACTCAACCAGGATATGAAAGAAATATACTCACCAAAGG
AATGCCTTCTCGCTTGGTTGAAATAGACTTCAAAACTACGGACTATACGCCGCTTGACCTTCACAACTGGAAACC
TACTTAGTCCCGTTTCTGATGGATTTGGATCCCCTGGCATCAGTCTGGCTAGACTAACACTCAGGTTCATCGAGC
GAACGGTGATTCGTCTGTATTCTCGGATTTATCTTCCATCTCATTATTTTATTTCCTTCCTAGACCTCAGCACCC
CGGATGAGCTGTCACGAACTGGAGCAGATTGGCCTATTCTGTAGGAGCGTCTGTGCGCAGTCTGAGACTATACAT
TCGAAACAGGGGAAGATAGGACCTTTTCCCTTAACAGATGTCGCTAACGAAAGGATCGTTCCCAGTGCCGGGAGG
ATAAGTGGAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail