Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010770
Gene name
Locationscaffold_1:2546365..2547900
Strand+
Gene length (bp)1535
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 2.4E-06 99 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13717|YDZA_SCHPO Uncharacterized protein C14C4.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.10c PE=3 SV=1 105 254 3.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 413 435 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010770
MSAEKANPPPLSVTPLLARALQRIRATPPRIIASPPTQPRRAAVALIVRVVPSPTAKLPDPTSPPPSLTEFFEED
WVNDPGSRAEILFLHRQADFADNVALTQSRTTNGREAHVAFPGGRTERDDEGGLYTAMRQTWEEIGIDLAEKNYT
CVGQLDDREITTSLGKRLLMILSPFVFLQVTPTASPPDPIATTSLHWIPLASLVSPISSPKWSSVTVDAASRIVR
RNSTALRVLIRALVGSMKFPAIIIEHGPSPPINSGRTAPLQKSEKKLTSPHDVIEKGYSPKVLKLWGLSLGMTLD
LMSYMILPESSRDMMPPKEEGNNSPLSHYMQLPYQDVVEDFRVEYVAPSLASVFPKFSYPDVNFWIWVFGKRYRE
VIRGWETSLRGGGVNDRRINWSGSALSTFYAAIRKALVVVIVARALGILFGIAFAGWWIFSQ*
Coding >AgabiH97|010770
ATGTCTGCCGAAAAAGCGAATCCTCCGCCGCTCTCAGTCACGCCGCTCCTCGCCCGCGCCCTCCAGCGCATCCGC
GCAACCCCGCCACGCATCATCGCATCTCCTCCTACCCAACCTCGTCGGGCCGCGGTCGCTCTCATAGTTCGCGTC
GTACCTTCACCAACCGCAAAACTCCCAGATCCTACATCCCCACCTCCCTCTCTTACCGAGTTCTTTGAAGAAGAT
TGGGTCAACGATCCGGGTTCTCGCGCAGAAATCCTTTTCCTACACCGTCAGGCAGACTTTGCAGACAATGTGGCA
TTGACACAAAGTCGTACGACCAATGGGCGTGAGGCTCACGTTGCTTTTCCCGGTGGTAGAACTGAGCGAGACGAC
GAGGGCGGCTTGTACACGGCAATGCGTCAAACATGGGAAGAAATTGGTATCGACCTCGCTGAAAAAAACTACACA
TGCGTTGGCCAGCTGGACGACCGCGAAATCACTACCTCACTCGGGAAACGGCTGCTTATGATCCTCTCCCCTTTT
GTTTTTCTCCAAGTTACGCCCACAGCCTCTCCTCCCGATCCAATTGCTACGACCTCTCTTCATTGGATACCGCTC
GCTTCCCTTGTCTCACCTATTTCCTCCCCTAAGTGGTCTTCCGTTACCGTTGATGCAGCGTCTCGGATCGTGCGC
CGCAATTCTACCGCCCTTCGCGTCCTGATTCGCGCCCTTGTGGGTAGTATGAAATTTCCCGCTATCATTATCGAA
CATGGACCCTCCCCTCCCATCAACTCCGGCCGCACAGCTCCTTTGCAAAAGAGCGAGAAAAAGCTGACGAGCCCG
CATGATGTCATTGAAAAGGGCTATTCTCCCAAAGTCCTCAAACTCTGGGGGCTTTCCCTTGGCATGACTCTTGAC
CTCATGTCCTACATGATTTTACCCGAATCCTCACGCGACATGATGCCGCCTAAAGAAGAAGGCAACAACTCGCCG
CTATCACATTACATGCAGTTACCCTATCAGGATGTCGTGGAGGACTTTCGTGTGGAGTATGTGGCCCCCAGTCTT
GCAAGCGTATTTCCAAAGTTTTCCTATCCCGACGTCAACTTTTGGATCTGGGTATTTGGTAAACGTTATCGAGAG
GTTATCCGTGGCTGGGAGACAAGTTTACGTGGCGGAGGTGTAAATGACCGCCGAATAAATTGGTCAGGGTCTGCC
CTGAGTACCTTTTACGCTGCCATCCGCAAGGCTTTAGTTGTCGTCATCGTTGCTCGTGCACTTGGTATCTTGTTT
GGTATCGCCTTTGCAGGTTGGTGGATCTTTAGCCAGTAG
Transcript >AgabiH97|010770
ATGTCTGCCGAAAAAGCGAATCCTCCGCCGCTCTCAGTCACGCCGCTCCTCGCCCGCGCCCTCCAGCGCATCCGC
GCAACCCCGCCACGCATCATCGCATCTCCTCCTACCCAACCTCGTCGGGCCGCGGTCGCTCTCATAGTTCGCGTC
GTACCTTCACCAACCGCAAAACTCCCAGATCCTACATCCCCACCTCCCTCTCTTACCGAGTTCTTTGAAGAAGAT
TGGGTCAACGATCCGGGTTCTCGCGCAGAAATCCTTTTCCTACACCGTCAGGCAGACTTTGCAGACAATGTGGCA
TTGACACAAAGTCGTACGACCAATGGGCGTGAGGCTCACGTTGCTTTTCCCGGTGGTAGAACTGAGCGAGACGAC
GAGGGCGGCTTGTACACGGCAATGCGTCAAACATGGGAAGAAATTGGTATCGACCTCGCTGAAAAAAACTACACA
TGCGTTGGCCAGCTGGACGACCGCGAAATCACTACCTCACTCGGGAAACGGCTGCTTATGATCCTCTCCCCTTTT
GTTTTTCTCCAAGTTACGCCCACAGCCTCTCCTCCCGATCCAATTGCTACGACCTCTCTTCATTGGATACCGCTC
GCTTCCCTTGTCTCACCTATTTCCTCCCCTAAGTGGTCTTCCGTTACCGTTGATGCAGCGTCTCGGATCGTGCGC
CGCAATTCTACCGCCCTTCGCGTCCTGATTCGCGCCCTTGTGGGTAGTATGAAATTTCCCGCTATCATTATCGAA
CATGGACCCTCCCCTCCCATCAACTCCGGCCGCACAGCTCCTTTGCAAAAGAGCGAGAAAAAGCTGACGAGCCCG
CATGATGTCATTGAAAAGGGCTATTCTCCCAAAGTCCTCAAACTCTGGGGGCTTTCCCTTGGCATGACTCTTGAC
CTCATGTCCTACATGATTTTACCCGAATCCTCACGCGACATGATGCCGCCTAAAGAAGAAGGCAACAACTCGCCG
CTATCACATTACATGCAGTTACCCTATCAGGATGTCGTGGAGGACTTTCGTGTGGAGTATGTGGCCCCCAGTCTT
GCAAGCGTATTTCCAAAGTTTTCCTATCCCGACGTCAACTTTTGGATCTGGGTATTTGGTAAACGTTATCGAGAG
GTTATCCGTGGCTGGGAGACAAGTTTACGTGGCGGAGGTGTAAATGACCGCCGAATAAATTGGTCAGGGTCTGCC
CTGAGTACCTTTTACGCTGCCATCCGCAAGGCTTTAGTTGTCGTCATCGTTGCTCGTGCACTTGGTATCTTGTTT
GGTATCGCCTTTGCAGGTTGGTGGATCTTTAGCCAGTAG
Gene >AgabiH97|010770
ATGTCTGCCGAAAAAGCGAATCCTCCGCCGCTCTCAGTCACGCCGCTCCTCGCCCGCGCCCTCCAGCGCATCCGC
GCAACCCCGCCACGCATCATCGCATCTCCTCCTACCCGTGCGCTAACTTTTTCTTGTACTTTCTACCCCAGCTCA
TCTCTGTCTTCCAGAACCTCGTCGGGCCGCGGTCGCTCTCATAGTTCGCGTCGTACCTTCACCAACCGCAAAACT
CCCAGATCCTACATCCCCACCTCCCTCTCTTACCGAGTTCTTTGAAGAAGATTGGGTCAACGATCCGGGTTCTCG
CGCAGAAATCCTTTTCCTACACCGTCAGGCAGACTTTGCAGACAATGTGGCATTGACACAAAGTCGTACGACCAA
TGGGCGTGAGGCTCACGTTGCTTTTCCCGGTGGTAGAACTGAGCGAGACGACGAGGGCGGCTTGTACACGGGTAT
GTTCGGCCGATTCTCGCTCTTATCTTGTTTCTTAAGCGTCCCACAGCAATGCGTCAAACATGGGAAGAAATTGGT
ATCGACCTCGCTGAAAAAAACTACACATGCGTTGGCCAGCTGGACGACCGCGAAATCACTACCTCACTCGGGAAA
CGGCTGCTTATGATCCTCTCCCCTTTTGTTTTTCTCCAAGTTACGCCCACAGCCTCTCCTCCCGATCCAATTGCT
ACGACCTCTCTTCATTGGATACCGCTCGCTTCCCTTGTCTCACCTATTTCCTCCCCTAAGTGGTCTTCCGTTACC
GTTGATGCAGCGTCTCGGATCGTGCGCCGCAATTCTACCGCCCTTCGCGTCCTGATTCGCGCCCTTGTGGGTAGT
ATGAAATTTCCCGCTATCATTATCGAACATGGACCCTCCCCTCCCATCAACTCCGGCCGCACAGCTCCTTTGCAA
AAGAGCGAGAAAAAGCTGACGAGCCCGCATGATGTCATTGAAAAGGGCTATTCTCCCAAAGTCCTCAAACTCTGG
GGGCTTTCCCTTGGCATGACTCTTGACCTCATGTCCTACATGATTTTACCCGAATCCTCACGCGACATGATGCCG
CCTAAAGAAGAAGGCAACAACTCGCCGCTATCACATTACATGCAGTTACCCTATCAGGATGTCGTGGAGGACTTT
CGTGTGGAGTATGTGGCCCCCAGTCTTGCAAGCGTATTTCCAAAGTTTTCCTATCCCGACGTCAACTTTTGGATC
TGGTAAGCATTTTCTTCATCGGGACATTTTTCTTTTCTCAACGCTATCTTTATTGTTATAGGGTATTTGGTAAAC
GTTATCGAGAGGTTATCCGTGGCTGGGAGACAAGTTTACGTGGCGGAGGTGTAAATGACCGCCGGTGAGTGGATA
CGGCTATCTCTAACCAATTTGAGTCGTGGAAGCTAAACGTCGTTTCTAGAATAAATTGGTCAGGGTCTGCCCTGA
GTACCTTTTACGCTGCCATCCGCAAGGCTTTAGTTGTCGTCATCGTTGCTCGTGCACTTGGTATCTTGTTTGGTA
TCGCCTTTGCAGGTTGGTGGATCTTTAGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail