Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010560
Gene name
Locationscaffold_1:2487936..2488644
Strand-
Gene length (bp)708
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010560
MYFKLFAAALFASAAFTAFASPQPLPTPAPVVRELEARQDPIDDFTSFAASVITDDGASVFSDATSVIGSVGSQV
TSAAGNVITSVTSVGGKAFTYVSSAGGEALTLAESGAGVATTAFGSVYSVVASDFASVTSDAADATSTNAAAGTR
LTGFSSPVMVGLVTIMGSALLGAAVTL*
Coding >AgabiH97|010560
ATGTATTTCAAGCTTTTCGCTGCCGCTCTCTTTGCATCTGCTGCATTCACTGCCTTTGCTTCACCTCAACCTCTA
CCCACTCCAGCACCCGTGGTACGCGAACTGGAGGCTCGCCAAGATCCCATTGACGATTTCACATCATTTGCCGCT
TCGGTCATCACAGACGATGGTGCCTCCGTCTTCTCCGATGCAACTTCTGTTATCGGAAGCGTCGGTTCTCAAGTC
ACCAGCGCAGCTGGAAATGTTATAACTTCGGTTACCTCGGTTGGTGGGAAAGCGTTTACATACGTCTCAAGTGCT
GGTGGTGAGGCTCTGACCCTCGCCGAATCCGGGGCAGGTGTCGCTACTACAGCCTTTGGCTCCGTCTATAGTGTC
GTGGCTTCTGATTTTGCCAGCGTTACCAGTGATGCTGCTGATGCCACCAGTACCAACGCTGCTGCTGGTACTCGT
CTGACAGGATTCTCATCACCAGTGATGGTTGGTCTAGTAACAATAATGGGCAGTGCACTGCTGGGTGCCGCCGTC
ACTTTATAA
Transcript >AgabiH97|010560
ATGTATTTCAAGCTTTTCGCTGCCGCTCTCTTTGCATCTGCTGCATTCACTGCCTTTGCTTCACCTCAACCTCTA
CCCACTCCAGCACCCGTGGTACGCGAACTGGAGGCTCGCCAAGATCCCATTGACGATTTCACATCATTTGCCGCT
TCGGTCATCACAGACGATGGTGCCTCCGTCTTCTCCGATGCAACTTCTGTTATCGGAAGCGTCGGTTCTCAAGTC
ACCAGCGCAGCTGGAAATGTTATAACTTCGGTTACCTCGGTTGGTGGGAAAGCGTTTACATACGTCTCAAGTGCT
GGTGGTGAGGCTCTGACCCTCGCCGAATCCGGGGCAGGTGTCGCTACTACAGCCTTTGGCTCCGTCTATAGTGTC
GTGGCTTCTGATTTTGCCAGCGTTACCAGTGATGCTGCTGATGCCACCAGTACCAACGCTGCTGCTGGTACTCGT
CTGACAGGATTCTCATCACCAGTGATGGTTGGTCTAGTAACAATAATGGGCAGTGCACTGCTGGGTGCCGCCGTC
ACTTTATAA
Gene >AgabiH97|010560
ATGTATTTCAAGCTTTTCGCTGCCGCTCTCTTTGCATCTGCTGCATTCACTGCCTTTGCTTCACCTCAACCTCTA
CCCACTCCAGCACCCGTGGTACGCGAACTGGAGGCTCGCCAAGATCGTACGTTTGATTCCCCTCAATAGCGAAGC
AGTTTTGTGATTGACGCGCCTTGCTATCTAGCCATTGACGATTTCACATCATTTGCCGCTTCGGTCATCACAGAC
GATGGTACGTAATATATTTCCCCTCTCAACTCTCCCCAATTTCTAAATCGATTATTAGGTGCCTCCGTCTTCTCC
GATGCAACTTCTGTTATCGGAAGCGTCGGTTCTCAAGTCACCAGCGCAGCTGGAAATGTTATAACTTCGGTTACC
TGTACGTTTTATATTGTCATTTTACAATCTTTGTCTCCACAGCTAATCCGGTTTTCAACAGCGGTTGGTGGGAAA
GCGTTTACATACGTCTCAAGTGCTGGTGGTGAGGCTCTGACCCTCGCCGAATCCGGGGCAGGTGTCGCTACTACA
GCCTTTGGCTCCGTCTATAGTGTCGTGGCTTCTGATTTTGCCAGCGTTACCAGTGATGCTGCTGATGCCACCAGT
ACCAACGCTGCTGCTGGTACTCGTCTGACAGGATTCTCATCACCAGTGATGGTTGGTCTAGTAACAATAATGGGC
AGTGCACTGCTGGGTGCCGCCGTCACTTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail