Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010530
Gene name
Locationscaffold_1:2480142..2482027
Strand-
Gene length (bp)1885
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 1.3E-10 107 146
PF00514 Arm Armadillo/beta-catenin-like repeat 3.3E-12 149 187
PF00514 Arm Armadillo/beta-catenin-like repeat 3.6E-11 190 231
PF00514 Arm Armadillo/beta-catenin-like repeat 1.4E-04 241 272
PF00514 Arm Armadillo/beta-catenin-like repeat 4.8E-08 275 314
PF00514 Arm Armadillo/beta-catenin-like repeat 6.8E-12 318 356
PF00514 Arm Armadillo/beta-catenin-like repeat 7.2E-12 359 398
PF00514 Arm Armadillo/beta-catenin-like repeat 3.0E-05 406 442
PF01749 IBB Importin beta binding domain 9.5E-24 13 96
PF13513 HEAT_EZ HEAT-like repeat 3.0E-07 133 186
PF13513 HEAT_EZ HEAT-like repeat 2.7E-05 344 396
PF16186 Arm_3 Atypical Arm repeat 1.5E-21 459 508
PF02985 HEAT HEAT repeat 3.8E-04 161 187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens GN=KPNA5 PE=1 SV=2 13 533 0.0E+00
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 6 533 0.0E+00
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 11 502 0.0E+00
sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus GN=Kpna5 PE=2 SV=1 13 533 0.0E+00
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 7 534 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens GN=KPNA5 PE=1 SV=2 13 533 0.0E+00
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 6 533 0.0E+00
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 11 502 0.0E+00
sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus GN=Kpna5 PE=2 SV=1 13 533 0.0E+00
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 7 534 0.0E+00
sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus GN=Kpna1 PE=1 SV=1 13 530 0.0E+00
sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus GN=Kpna1 PE=1 SV=2 13 533 0.0E+00
sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii GN=KPNA1 PE=2 SV=1 13 533 0.0E+00
sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 13 533 0.0E+00
sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus GN=KPNA1 PE=2 SV=1 13 533 0.0E+00
sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 5 533 0.0E+00
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 7 534 0.0E+00
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 13 533 0.0E+00
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 37 533 0.0E+00
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 13 533 0.0E+00
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 1 525 0.0E+00
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 1 533 0.0E+00
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 11 533 0.0E+00
sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana GN=IMPA4 PE=1 SV=1 13 534 0.0E+00
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 7 535 0.0E+00
sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 7 534 0.0E+00
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 11 533 0.0E+00
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 37 533 0.0E+00
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 37 533 0.0E+00
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 37 533 0.0E+00
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 7 502 3.0E-169
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 12 533 7.0E-158
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 1 533 1.0E-155
sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis thaliana GN=IMPA7 PE=2 SV=1 9 497 2.0E-152
sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens GN=KPNA4 PE=1 SV=1 13 533 2.0E-151
sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus GN=Kpna4 PE=1 SV=1 13 533 4.0E-151
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 10 535 7.0E-150
sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis GN=kpna1 PE=1 SV=2 13 504 8.0E-149
sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 13 533 1.0E-147
sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna3 PE=1 SV=1 13 533 6.0E-147
sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis GN=kpna2 PE=1 SV=2 13 521 1.0E-146
sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster GN=Pen PE=1 SV=2 12 533 6.0E-132
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 1 518 1.0E-128
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 1 509 3.0E-127
sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dictyostelium discoideum GN=DDB_G0273149 PE=3 SV=1 12 520 3.0E-125
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 11 505 1.0E-120
sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis thaliana GN=IMPA8 PE=3 SV=1 75 493 2.0E-106
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 7 505 7.0E-105
sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis elegans GN=ima-2 PE=1 SV=1 4 501 4.0E-98
sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os01g0158000 PE=2 SV=1 10 504 1.0E-47
sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis thaliana GN=IMPA9 PE=3 SV=1 30 504 4.0E-46
sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis elegans GN=ima-1 PE=1 SV=1 194 501 9.0E-17
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 83 395 2.0E-14
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 111 378 2.0E-14
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 111 378 4.0E-13
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 111 394 5.0E-11
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 109 477 7.0E-11
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 77 394 1.0E-09
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 77 394 1.0E-09
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 157 394 1.0E-09
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 79 357 5.0E-09
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 83 460 5.0E-09
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 83 531 7.0E-09
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 107 306 1.0E-08
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 157 394 2.0E-08
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 89 387 3.0E-08
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 79 357 4.0E-08
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 201 396 5.0E-08
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 201 396 5.0E-08
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 167 465 7.0E-08
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 154 394 7.0E-08
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 90 211 7.0E-08
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 79 357 4.0E-07
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 89 387 8.0E-07
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 74 376 8.0E-07
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 83 467 1.0E-06
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 156 460 1.0E-06
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 156 460 1.0E-06
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 77 376 2.0E-06
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 79 357 4.0E-06
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 79 357 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006606 protein import into nucleus Yes
GO:0005515 protein binding Yes
GO:0061608 nuclear import signal receptor activity Yes
GO:0006810 transport No
GO:0015031 protein transport No
GO:0071705 nitrogen compound transport No
GO:0033365 protein localization to organelle No
GO:0140142 nucleocytoplasmic carrier activity No
GO:0051234 establishment of localization No
GO:0005488 binding No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0051170 import into nucleus No
GO:0034504 protein localization to nucleus No
GO:0051169 nuclear transport No
GO:0051179 localization No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0006913 nucleocytoplasmic transport No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0072594 establishment of protein localization to organelle No
GO:0140104 molecular carrier activity No
GO:0051649 establishment of localization in cell No
GO:0006886 intracellular protein transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010530
MDAATESRTMKARREAYKGKSGLKTDELRRRREEQQVEIRRQKREENISKRRNFLPAASGDSDDEISGGTWDPPL
AEEMIAGVFSDDPERQLDATTKFRKLLSKEKNPPIERVIECGVVPRFVEFLRTGHSMLQFESAWALTNIASGTAE
HTQVVINAGAVPEFINLLSSPVLDVREQAVWALGNIAGDSPQCRDYVLQAGALRPLLALLSEQHKLSMLRNATWT
LSNFCRGKSPQPDWELISPALTVLTKLIYSLDDEILIDACWAISYLSDGSNDKIQAVIESGVCRRLVDLLMHQST
AVQTPALRSVGNIVTGDDLQTQVVIASGALPALLSLLSSPKDGIRKEACWTISNVTAGSPPQIQSVVDANIIPPL
INILSNADFKTRKEACWAISNATSGGLQEPSQIRYLVSQGCIKPLCDLLTMMDNKIIQVALDGLDNILKVGEMDK
LAAGPGAVNQYALFVEEAGGMVTIHNLQQHDNLEIYKKAFNIMDKYFPDEEEVDTNISAPTVDASGAFAFHSDVS
APQGGFSFGQ*
Coding >AgabiH97|010530
ATGGATGCTGCAACGGAGTCACGCACGATGAAGGCCAGGAGAGAAGCCTACAAGGGTAAATCAGGTCTCAAGACA
GACGAACTCAGACGTCGCCGAGAGGAACAGCAGGTCGAGATTAGGCGTCAAAAGCGTGAAGAAAACATCTCCAAG
AGACGCAATTTTCTTCCTGCTGCCAGCGGCGATTCGGACGATGAAATTAGCGGTGGTACTTGGGATCCTCCTCTT
GCAGAGGAGATGATCGCTGGTGTCTTCTCTGATGATCCTGAGCGTCAACTAGACGCGACCACTAAGTTTCGCAAG
TTACTCTCGAAAGAGAAGAACCCTCCGATCGAGCGCGTCATTGAATGTGGTGTTGTCCCACGTTTCGTTGAATTT
TTGAGGACTGGACATTCCATGTTACAGTTCGAATCAGCATGGGCTTTGACCAACATTGCATCCGGAACGGCGGAG
CACACCCAGGTCGTTATCAACGCAGGGGCGGTTCCAGAATTCATTAATCTCCTGTCCTCACCCGTCCTCGACGTC
CGTGAGCAAGCTGTGTGGGCATTGGGTAACATCGCGGGTGATAGCCCTCAGTGCAGAGACTATGTTCTCCAAGCT
GGCGCTTTGAGGCCACTCTTGGCTTTATTGAGTGAACAACACAAACTCAGCATGTTGAGGAACGCTACCTGGACT
TTGAGCAACTTCTGCCGTGGAAAATCTCCTCAACCTGACTGGGAACTAATCTCCCCCGCTCTTACAGTCTTGACG
AAGCTTATCTACTCTCTTGATGATGAGATTCTCATCGATGCTTGCTGGGCTATCTCCTACCTCTCAGACGGATCG
AACGACAAAATCCAAGCTGTGATTGAATCTGGTGTTTGCAGGCGTCTTGTTGACCTCCTGATGCACCAATCTACT
GCCGTTCAAACCCCCGCCCTTCGTTCCGTTGGCAATATTGTTACCGGTGACGACCTCCAGACACAGGTCGTTATC
GCCTCCGGTGCTCTTCCTGCCCTTCTCTCTCTTCTTTCTTCGCCCAAGGATGGTATCAGGAAAGAGGCGTGTTGG
ACTATTTCTAATGTTACGGCAGGATCTCCTCCTCAAATTCAGTCCGTTGTCGACGCAAATATCATTCCTCCGCTT
ATCAATATCCTCTCGAATGCCGATTTTAAGACCAGGAAGGAGGCTTGCTGGGCCATCTCCAACGCCACCTCTGGA
GGCCTGCAAGAACCCTCCCAGATTCGTTATCTCGTTTCGCAAGGATGCATCAAACCTCTCTGTGATTTGTTGACT
ATGATGGATAACAAGATCATTCAGGTCGCTCTTGATGGTTTGGACAATATCTTAAAAGTTGGCGAAATGGACAAG
TTGGCTGCCGGTCCTGGTGCTGTCAACCAATATGCTCTTTTCGTTGAAGAGGCCGGTGGAATGGTCACTATCCAC
AACCTTCAACAGCATGATAATTTGGAAATCTATAAAAAGGCCTTCAATATCATGGACAAATATTTCCCTGATGAG
GAAGAAGTTGATACTAATATCAGCGCTCCCACCGTCGATGCAAGCGGTGCTTTTGCTTTCCATTCAGATGTAAGT
GCCCCTCAAGGTGGATTCAGCTTTGGCCAGTAG
Transcript >AgabiH97|010530
ATGGATGCTGCAACGGAGTCACGCACGATGAAGGCCAGGAGAGAAGCCTACAAGGGTAAATCAGGTCTCAAGACA
GACGAACTCAGACGTCGCCGAGAGGAACAGCAGGTCGAGATTAGGCGTCAAAAGCGTGAAGAAAACATCTCCAAG
AGACGCAATTTTCTTCCTGCTGCCAGCGGCGATTCGGACGATGAAATTAGCGGTGGTACTTGGGATCCTCCTCTT
GCAGAGGAGATGATCGCTGGTGTCTTCTCTGATGATCCTGAGCGTCAACTAGACGCGACCACTAAGTTTCGCAAG
TTACTCTCGAAAGAGAAGAACCCTCCGATCGAGCGCGTCATTGAATGTGGTGTTGTCCCACGTTTCGTTGAATTT
TTGAGGACTGGACATTCCATGTTACAGTTCGAATCAGCATGGGCTTTGACCAACATTGCATCCGGAACGGCGGAG
CACACCCAGGTCGTTATCAACGCAGGGGCGGTTCCAGAATTCATTAATCTCCTGTCCTCACCCGTCCTCGACGTC
CGTGAGCAAGCTGTGTGGGCATTGGGTAACATCGCGGGTGATAGCCCTCAGTGCAGAGACTATGTTCTCCAAGCT
GGCGCTTTGAGGCCACTCTTGGCTTTATTGAGTGAACAACACAAACTCAGCATGTTGAGGAACGCTACCTGGACT
TTGAGCAACTTCTGCCGTGGAAAATCTCCTCAACCTGACTGGGAACTAATCTCCCCCGCTCTTACAGTCTTGACG
AAGCTTATCTACTCTCTTGATGATGAGATTCTCATCGATGCTTGCTGGGCTATCTCCTACCTCTCAGACGGATCG
AACGACAAAATCCAAGCTGTGATTGAATCTGGTGTTTGCAGGCGTCTTGTTGACCTCCTGATGCACCAATCTACT
GCCGTTCAAACCCCCGCCCTTCGTTCCGTTGGCAATATTGTTACCGGTGACGACCTCCAGACACAGGTCGTTATC
GCCTCCGGTGCTCTTCCTGCCCTTCTCTCTCTTCTTTCTTCGCCCAAGGATGGTATCAGGAAAGAGGCGTGTTGG
ACTATTTCTAATGTTACGGCAGGATCTCCTCCTCAAATTCAGTCCGTTGTCGACGCAAATATCATTCCTCCGCTT
ATCAATATCCTCTCGAATGCCGATTTTAAGACCAGGAAGGAGGCTTGCTGGGCCATCTCCAACGCCACCTCTGGA
GGCCTGCAAGAACCCTCCCAGATTCGTTATCTCGTTTCGCAAGGATGCATCAAACCTCTCTGTGATTTGTTGACT
ATGATGGATAACAAGATCATTCAGGTCGCTCTTGATGGTTTGGACAATATCTTAAAAGTTGGCGAAATGGACAAG
TTGGCTGCCGGTCCTGGTGCTGTCAACCAATATGCTCTTTTCGTTGAAGAGGCCGGTGGAATGGTCACTATCCAC
AACCTTCAACAGCATGATAATTTGGAAATCTATAAAAAGGCCTTCAATATCATGGACAAATATTTCCCTGATGAG
GAAGAAGTTGATACTAATATCAGCGCTCCCACCGTCGATGCAAGCGGTGCTTTTGCTTTCCATTCAGATGTAAGT
GCCCCTCAAGGTGGATTCAGCTTTGGCCAGTAG
Gene >AgabiH97|010530
ATGGATGCTGCAACGGAGTCACGCACGATGAAGGCCAGGAGAGAAGGTCTGTCGTTGCATGCTGATCACGATTAA
TGCTCATACGCGCGCTCCGACAGCCTACAAGGGTAAATCAGGTCTCAAGACAGACGAACTCAGACGTCGCCGAGA
GGAACAGCAGGTCGAGATTAGGCGTCAAAAGCGTGAAGAAAACATCTCCAAGAGACGCAATTTTCTTCCTGCTGC
CAGCGGCGATTCGGACGATGAAATTAGCGGTGGTACTTGGGATCCTCCTGTATCTATTCCCTTCAACTCCTCGTG
ACTGAGTTTGGCTTACGAATGTGTCTCTAGCTTGCAGAGGAGATGATCGCTGGTGTCTTCTCTGATGATCCTGAG
CGTCAACTAGACGCGACCACTAAGTTTCGCAAGTTACTCTCGAAAGAGAAGAACCCTCCGATCGAGCGCGTCATT
GAATGTGGTGTTGTCCCACGTTTCGTTGAATTTTTGAGGACTGGACATTCCATGTTACAGGTATGCCACTGACTA
TGTATATACAAGTCGTCCTTTGGTCCTCATTATCTTTCAGTTCGAATCAGCATGGGCTTTGACCAACATTGCATC
CGGAACGGCGGAGCACACCCAGGTCGTTATCAACGCAGGGGCGGTTCCAGAATTCATTAATCTCCTGTCCTCACC
CGTCCTCGACGTCCGTGAGCAAGCTGTGTGGGCATTGGGTAACATCGCGGGTGATAGCCCTCAGTGCAGAGACTA
TGTTCTCCAAGCTGGCGCTTTGAGGCCACTCTTGGCTTTATTGAGTGAACAACACAAACTCAGCATGTTGAGGAA
CGCTACCTGGACTTTGAGCAACTTCTGCCGTGGAAAATCTCCTCAACCTGACTGGGAACTAGTAAGTCCCTTGCA
GTTATTTACTAATTGAAAATCTGAGAGTCAACCTTCTTAGATCTCCCCCGCTCTTACAGTCTTGACGAAGCTTAT
CTACTCTCTTGATGATGAGATTCTCATCGATGCTTGCTGGGCTATCTCCTACCTCTCAGACGGATCGAACGACAA
AATCCAAGCTGTGATTGAATCTGGTGTTTGCAGGCGTCTTGTTGACCTCCTGATGCACCAATCTACTGCCGTTCA
AACCCCCGCCCTTCGTTCCGTTGGCAATATTGTTACCGGTGACGACCTCCAGACACAGGTCGTTATCGCCTCCGG
TGCTCTTCCTGCCCTTCTCTCTCTTCTTTCTTCGCCCAAGGATGGTATCAGGAAAGAGGCGTGTTGGACTATTTC
TAATGTTACGGCAGGATCTCCTCCTCAAATTCAGTCCGTTGTCGACGCAAATATCATTCCTCCGCTTATCAATAT
CCTCTCGAATGCCGATTTTAAGACCAGGAAGGAGGCTTGCTGGGCCATCTCCAACGCCACCTCTGGAGGCCTGCA
AGAACCCTCCCAGATTCGTTATCTCGTTTCGCAAGGATGCATCAAACCTCTCTGTGATTTGTTGACTATGATGGA
TAACAAGATCATTCAGGTCGCTCTTGATGGTTTGGACAATATCTTAAAAGTTGGCGAAATGGACAAGTTGGCTGC
CGGTCCTGGTGCTGTCAACCAATATGCTCTTTTCGTTGAAGAGGCCGGTGGAATGGTCACTATCCACAACCTTCA
ACAGCATGATAATTTGGAAATCTATAAAAAGGCCTTCAATATCATGGACAAATATTTCCCTGATGAGGAAGAAGT
TGATACTAATATCAGCGCTCCCACCGTCGATGCAAGCGGTGCTTTTGCTGTAAGTCACTCTTCGTCTATTTGCCG
CTGATGCAAAGGATCTGATGTCTTCTCTTCATAGTTCCATTCAGATGTAAGTGCCCCTCAAGGTGGATTCAGCTT
TGGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail