Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010460
Gene name
Locationscaffold_1:2467727..2468646
Strand+
Gene length (bp)919
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10213 MRP-S28 Mitochondrial ribosomal subunit protein 1.9E-21 100 253

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03976|RT24_YEAST 37S ribosomal protein S24, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM24 PE=1 SV=1 67 253 3.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010460
MASSLSRLTRRTLLSHATAPSSPQILSRFFSASSPACARRTKTKLEEDIDMDELMEYLEDPGTNDSPSSSHLMLQ
EQRIVRHYLRLIEHEMPHLAALRKPFVPPTSEQPLVVRSIEYVGSKPTIKRSMVVAVDDLPLKDEKALKRLVLLA
GPRWTPSPPADAGISKHAEWKHGFVKISCEDFMQPARNLKWISDTLDRLVERANSPAKEDGVWDGLPVDLRHVMA
KSKKGKKGDHLRGRVLAKPTLRDFPREWLPKSPTTHEQPSLSSS*
Coding >AgabiH97|010460
ATGGCGTCGTCATTATCTCGTCTGACCAGACGCACTCTACTCAGTCATGCTACAGCTCCCTCATCCCCTCAGATA
TTGTCTCGCTTTTTCTCTGCCTCTTCTCCTGCTTGTGCTCGCCGTACGAAGACCAAGCTTGAAGAAGATATAGAC
ATGGACGAGCTTATGGAGTATCTTGAGGACCCGGGAACGAATGATTCACCTTCGTCGTCGCATTTGATGTTACAG
GAACAGCGCATAGTGAGGCATTACTTGCGGTTGATTGAGCATGAGATGCCTCATTTGGCCGCTTTGAGGAAACCT
TTTGTGCCGCCGACATCTGAACAACCGCTCGTCGTACGATCCATTGAATATGTGGGTTCAAAGCCTACTATTAAA
AGAAGTATGGTCGTGGCTGTCGATGATCTGCCTTTGAAGGATGAAAAGGCATTGAAGAGATTGGTTTTACTCGCT
GGTCCGAGATGGACACCAAGTCCTCCTGCAGACGCTGGTATCAGCAAACATGCGGAATGGAAACACGGATTTGTG
AAGATTTCTTGTGAAGATTTTATGCAACCTGCTAGGAATCTCAAGTGGATTAGTGATACGTTAGACAGACTAGTA
GAGAGAGCTAATAGTCCAGCTAAGGAGGATGGTGTTTGGGATGGTTTACCAGTTGATTTGCGCCATGTTATGGCC
AAATCGAAAAAGGGCAAAAAAGGCGATCATTTACGCGGTCGGGTCCTTGCTAAACCCACTCTTCGTGACTTCCCC
CGGGAGTGGCTGCCAAAGTCGCCTACAACTCATGAGCAACCATCATTGTCTTCATCCTAA
Transcript >AgabiH97|010460
ATGGCGTCGTCATTATCTCGTCTGACCAGACGCACTCTACTCAGTCATGCTACAGCTCCCTCATCCCCTCAGATA
TTGTCTCGCTTTTTCTCTGCCTCTTCTCCTGCTTGTGCTCGCCGTACGAAGACCAAGCTTGAAGAAGATATAGAC
ATGGACGAGCTTATGGAGTATCTTGAGGACCCGGGAACGAATGATTCACCTTCGTCGTCGCATTTGATGTTACAG
GAACAGCGCATAGTGAGGCATTACTTGCGGTTGATTGAGCATGAGATGCCTCATTTGGCCGCTTTGAGGAAACCT
TTTGTGCCGCCGACATCTGAACAACCGCTCGTCGTACGATCCATTGAATATGTGGGTTCAAAGCCTACTATTAAA
AGAAGTATGGTCGTGGCTGTCGATGATCTGCCTTTGAAGGATGAAAAGGCATTGAAGAGATTGGTTTTACTCGCT
GGTCCGAGATGGACACCAAGTCCTCCTGCAGACGCTGGTATCAGCAAACATGCGGAATGGAAACACGGATTTGTG
AAGATTTCTTGTGAAGATTTTATGCAACCTGCTAGGAATCTCAAGTGGATTAGTGATACGTTAGACAGACTAGTA
GAGAGAGCTAATAGTCCAGCTAAGGAGGATGGTGTTTGGGATGGTTTACCAGTTGATTTGCGCCATGTTATGGCC
AAATCGAAAAAGGGCAAAAAAGGCGATCATTTACGCGGTCGGGTCCTTGCTAAACCCACTCTTCGTGACTTCCCC
CGGGAGTGGCTGCCAAAGTCGCCTACAACTCATGAGCAACCATCATTGTCTTCATCCTAA
Gene >AgabiH97|010460
ATGGCGTCGTCATTATCTCGTCTGACCAGACGCACTCTACTCAGTCATGCTACAGCTCCCTCATCCCCTCAGATA
TTGTCTCGCTTTTTCTCTGCCTCTTCTCCTGCTTGTGCTCGCCGTACGAAGACCAAGCTTGAAGAAGATATAGAC
ATGGACGAGCTTATGGAGTATCTTGAGGACCCGGGAACGAATGATTCACCTTCGTCGTCGCATTTGATGTTACAG
GAACAGCGCATAGTGAGGCATTACTTGCGGTTGATTGAGCATGAGATGCCTCATTTGGCCGGTACGTTTATTTAT
TTCCGCTATGTACTCTAATAATCAACGAGTTTGACTAGCTTTGAGGAAACCTTTTGTGCCGCCGACATCTGAACA
ACCGCTCGTCGTACGATCCATTGAATATGTGGGTTCAAAGCCTACTATTAAAAGAAGTATGGTCGTGGCTGTCGA
TGATCTGCCTTTGAAGGATGAAAAGGCATTGAAGAGATTGGTTTTACTCGCTGGTCCGAGATGGACACCAAGTCC
TCCTGCAGACGCTGGTATCAGCAAACATGCGGAATGGAAACACGGATTTGTGAAGATTTCTTGTGAAGATTTTAT
GCAACCTGCTAGGAATCTCAAGTGGATTAGTGATACGTTAGACAGACTAGTAGAGAGAGCTAATGTAAGTTATTC
CAATTTGCCTCTTTCAGTTTTCTTGGATTCATGATTGTTTTTTTAGAGTCCAGCTAAGGAGGATGGTGTTTGGGA
TGGTTTACCAGTTGATTTGCGCCATGTTATGGCCAAATCGAAAAAGGGCAAAAAAGGCGATCATTTACGCGGTCG
GGTCCTTGCTAAACCCACTCTTCGTGACTTCCCCCGGGAGTGGCTGCCAAAGTCGCCTACAACTCATGAGCAACC
ATCATTGTCTTCATCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail