Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010270
Gene name
Locationscaffold_1:2414890..2416602
Strand+
Gene length (bp)1712
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide 0.0963 0.1045 0.3581 0.6543 0.1536 0.0043 0.0973 0.6222 0.1524 0.0579

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999625

Transmembrane Domains

Domain # Start End Length
1 268 290 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 3.95 1.67 6.22
Initials Initials knots 3.43 1.44 5.43
Pileal_Stipeal_center Stage I stipe center 4.46 1.94 6.99
Pileal_Stipeal_shell Stage I stipe shell 4.91 2.13 7.70
DIF_stipe_center Stage II stipe center 3.20 1.32 5.07
DIF_stipe_shell Stage II stipe shell 2.74 1.09 4.39
DIF_stipe_skin Stage II stipe skin 3.63 1.52 5.75
DIF_cap_skin Stage II cap skin 4.29 1.86 6.72
DIF_cap_tissue Stage II cap tissue 4.45 1.94 6.97
DIF_gill_tissue Stage II gill tissue 4.59 1.99 7.18
YFB_stipe_center Young fruiting body stipe center 2.79 1.12 4.46
YFB_stipe_shell Young fruiting body stipe shell 2.50 0.97 4.02
YFB_stipe_skin Young fruiting body stipe skin 3.05 1.24 4.87
YFB_cap_skin Young fruiting body cap skin 3.70 1.58 5.82
YFB_cap_tissue Young fruiting body cap tissue 3.26 1.35 5.17
YFB_gill_tissue Young fruiting body gill tissue 4.16 1.79 6.53
YFB_veil Young fruiting body veil 3.74 1.56 5.92

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.817727 no
Casing YFB_stipe_center 0.498596 no
Casing YFB_stipe_shell 0.329404 no
Casing YFB_stipe_skin 0.652826 no
Casing YFB_cap_skin 0.930984 no
Casing YFB_cap_tissue 0.753194 no
Casing YFB_gill_tissue 0.944800 no
Casing YFB_veil 0.941797 no
Casing Initials 0.833046 no
Casing Pileal_Stipeal_center 0.857522 no
Casing Pileal_Stipeal_shell 0.708192 no
Casing DIF_stipe_center 0.722928 no
Casing DIF_stipe_shell 0.473138 no
Casing DIF_stipe_skin 0.909899 no
Casing DIF_cap_skin 0.911208 no
Casing DIF_cap_tissue 0.859344 no
DIF_gill_tissue YFB_stipe_center 0.269269 no
DIF_gill_tissue YFB_stipe_shell 0.152605 no
DIF_gill_tissue YFB_stipe_skin 0.404825 no
DIF_gill_tissue YFB_cap_skin 0.718645 no
DIF_gill_tissue YFB_cap_tissue 0.496214 no
DIF_gill_tissue YFB_gill_tissue 0.896088 no
DIF_gill_tissue YFB_veil 0.730698 no
YFB_stipe_center YFB_stipe_shell 0.879219 no
YFB_stipe_center YFB_stipe_skin 0.905844 no
YFB_stipe_center YFB_cap_skin 0.613804 no
YFB_stipe_center YFB_cap_tissue 0.812614 no
YFB_stipe_center YFB_gill_tissue 0.406133 no
YFB_stipe_center YFB_veil 0.590463 no
YFB_stipe_shell YFB_stipe_skin 0.755394 no
YFB_stipe_shell YFB_cap_skin 0.427277 no
YFB_stipe_shell YFB_cap_tissue 0.636566 no
YFB_stipe_shell YFB_gill_tissue 0.251968 no
YFB_stipe_shell YFB_veil 0.404986 no
YFB_stipe_skin YFB_cap_skin 0.762124 no
YFB_stipe_skin YFB_cap_tissue 0.931940 no
YFB_stipe_skin YFB_gill_tissue 0.560654 no
YFB_stipe_skin YFB_veil 0.740066 no
YFB_cap_skin YFB_cap_tissue 0.854268 no
YFB_cap_skin YFB_gill_tissue 0.868224 no
YFB_cap_skin YFB_veil 0.988621 no
YFB_cap_tissue YFB_gill_tissue 0.662698 no
YFB_cap_tissue YFB_veil 0.838002 no
YFB_gill_tissue YFB_veil 0.874466 no
Initials DIF_gill_tissue 0.579754 no
Initials YFB_stipe_center 0.737140 no
Initials YFB_stipe_shell 0.544796 no
Initials YFB_stipe_skin 0.870648 no
Initials YFB_cap_skin 0.920469 no
Initials YFB_cap_tissue 0.949626 no
Initials YFB_gill_tissue 0.750987 no
Initials YFB_veil 0.905447 no
Initials Pileal_Stipeal_center 0.633398 no
Initials Pileal_Stipeal_shell 0.462544 no
Initials DIF_stipe_center 0.925104 no
Initials DIF_stipe_shell 0.709113 no
Initials DIF_stipe_skin 0.942106 no
Initials DIF_cap_skin 0.701728 no
Initials DIF_cap_tissue 0.633834 no
Pileal_Stipeal_center DIF_gill_tissue 0.973460 no
Pileal_Stipeal_center YFB_stipe_center 0.312021 no
Pileal_Stipeal_center YFB_stipe_shell 0.181928 no
Pileal_Stipeal_center YFB_stipe_skin 0.450181 no
Pileal_Stipeal_center YFB_cap_skin 0.765260 no
Pileal_Stipeal_center YFB_cap_tissue 0.541476 no
Pileal_Stipeal_center YFB_gill_tissue 0.926036 no
Pileal_Stipeal_center YFB_veil 0.777054 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.894002 no
Pileal_Stipeal_center DIF_stipe_center 0.510459 no
Pileal_Stipeal_center DIF_stipe_shell 0.284940 no
Pileal_Stipeal_center DIF_stipe_skin 0.731112 no
Pileal_Stipeal_center DIF_cap_skin 0.961017 no
Pileal_Stipeal_center DIF_cap_tissue 0.997574 no
Pileal_Stipeal_shell DIF_gill_tissue 0.928614 no
Pileal_Stipeal_shell YFB_stipe_center 0.191098 no
Pileal_Stipeal_shell YFB_stipe_shell 0.100731 no
Pileal_Stipeal_shell YFB_stipe_skin 0.297484 no
Pileal_Stipeal_shell YFB_cap_skin 0.598920 no
Pileal_Stipeal_shell YFB_cap_tissue 0.374795 no
Pileal_Stipeal_shell YFB_gill_tissue 0.793802 no
Pileal_Stipeal_shell YFB_veil 0.612952 no
Pileal_Stipeal_shell DIF_stipe_center 0.344060 no
Pileal_Stipeal_shell DIF_stipe_shell 0.173970 no
Pileal_Stipeal_shell DIF_stipe_skin 0.564693 no
Pileal_Stipeal_shell DIF_cap_skin 0.842101 no
Pileal_Stipeal_shell DIF_cap_tissue 0.888916 no
DIF_stipe_center DIF_gill_tissue 0.454137 no
DIF_stipe_center YFB_stipe_center 0.843917 no
DIF_stipe_center YFB_stipe_shell 0.670730 no
DIF_stipe_center YFB_stipe_skin 0.954144 no
DIF_stipe_center YFB_cap_skin 0.826764 no
DIF_stipe_center YFB_cap_tissue 0.980027 no
DIF_stipe_center YFB_gill_tissue 0.625975 no
DIF_stipe_center YFB_veil 0.807420 no
DIF_stipe_center DIF_stipe_shell 0.817521 no
DIF_stipe_center DIF_stipe_skin 0.851293 no
DIF_stipe_center DIF_cap_skin 0.574021 no
DIF_stipe_center DIF_cap_tissue 0.507422 no
DIF_stipe_shell DIF_gill_tissue 0.238543 no
DIF_stipe_shell YFB_stipe_center 0.983119 no
DIF_stipe_shell YFB_stipe_shell 0.899899 no
DIF_stipe_shell YFB_stipe_skin 0.885780 no
DIF_stipe_shell YFB_cap_skin 0.580296 no
DIF_stipe_shell YFB_cap_tissue 0.782614 no
DIF_stipe_shell YFB_gill_tissue 0.375280 no
DIF_stipe_shell YFB_veil 0.558472 no
DIF_stipe_shell DIF_stipe_skin 0.612598 no
DIF_stipe_shell DIF_cap_skin 0.333988 no
DIF_stipe_shell DIF_cap_tissue 0.281350 no
DIF_stipe_skin DIF_gill_tissue 0.681460 no
DIF_stipe_skin YFB_stipe_center 0.640545 no
DIF_stipe_skin YFB_stipe_shell 0.456993 no
DIF_stipe_skin YFB_stipe_skin 0.785448 no
DIF_stipe_skin YFB_cap_skin 0.980988 no
DIF_stipe_skin YFB_cap_tissue 0.878566 no
DIF_stipe_skin YFB_gill_tissue 0.840453 no
DIF_stipe_skin YFB_veil 0.970108 no
DIF_stipe_skin DIF_cap_skin 0.792599 no
DIF_stipe_skin DIF_cap_tissue 0.732173 no
DIF_cap_skin DIF_gill_tissue 0.930962 no
DIF_cap_skin YFB_stipe_center 0.362088 no
DIF_cap_skin YFB_stipe_shell 0.220802 no
DIF_cap_skin YFB_stipe_skin 0.515188 no
DIF_cap_skin YFB_cap_skin 0.823923 no
DIF_cap_skin YFB_cap_tissue 0.610721 no
DIF_cap_skin YFB_gill_tissue 0.968490 no
DIF_cap_skin YFB_veil 0.835355 no
DIF_cap_skin DIF_cap_tissue 0.962561 no
DIF_cap_tissue DIF_gill_tissue 0.971382 no
DIF_cap_tissue YFB_stipe_center 0.310686 no
DIF_cap_tissue YFB_stipe_shell 0.179947 no
DIF_cap_tissue YFB_stipe_skin 0.448703 no
DIF_cap_tissue YFB_cap_skin 0.767270 no
DIF_cap_tissue YFB_cap_tissue 0.539647 no
DIF_cap_tissue YFB_gill_tissue 0.929662 no
DIF_cap_tissue YFB_veil 0.778185 no

Orthologs

Orthofinder run ID1
Orthogroup920
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|010250
Agaricus bisporus var bisporus H39 AgabiH39|010260
Agaricus bisporus var bisporus H39 AgabiH39|010270
Agaricus bisporus var bisporus H97 AgabiH97|010250
Agaricus bisporus var bisporus H97 AgabiH97|010260
Agaricus bisporus var bisporus H97 AgabiH97|010270 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|1_80

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010270
MGSIPFRSSIIYFALFFQQVHGFTFITSQPTQCGELRFNWVGGTPPFTALVIAPFDIIRNISIPAQAWNERDQSG
DYSYLLNFNQSQKVVFSMGDATGPTTGGVTDVTTVGAPTQGSPPCTTSKHGPDFTFATTLPLSQCKNFSFGQLGS
AVQPISVLVTVPHGESFMLTAPLGDPFIWKANLTAGTNVIFTVKDAQNRLGGTSHILNVGTSDDSSCLGSPPISV
PPTRLPGVPTTSSLNPQHINTSSSSPTDSGSKNNHTDNKTGVIVGASVGGTVALLLTMALVYCLIRRKGGRNGIK
HIDLTGSTPGVSTSFMYHGHVAPTPYFVSSTGVVASQTTRNNGFPSASSTLTNIGTGPHVRNSSTAAAALAGTES
LAGTTDTEANHSVVSFKREVLQQRDGQLHLYFDPYAKNWWQQQDYDFEPYADATSHSQRIGSTSASGAGPASNPG
TTSRYSGATSP*
Coding >AgabiH97|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGCGGTACACCGCCATTCACTGCTCTC
GTAATAGCGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAATCGGGA
GATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGACCCACC
ACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCAAACAT
GGTCCCGATTTTACTTTCGCAACCACTTTACCACTTTCACAGTGCAAGAATTTTTCCTTCGGTCAGTTGGGTTCT
GCAGTGCAGCCAATATCAGTGCTTGTAACCGTACCTCACGGCGAATCCTTCATGTTGACCGCACCTCTCGGGGAT
CCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCACTGTGAAAGACGCTCAGAACCGCTTG
GGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGTGTTTGGGATCCCCTCCGATATCTGTC
CCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCACAACATATAAATACGTCTTCCAGTAGC
CCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGGTTATTGTCGGCGCCTCTGTCGGTGGA
ACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGACGGAAAGGTGGACGCAATGGCATCAAA
CACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGTATCATGGTCATGTCGCACCCACTCCT
TACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATAATGGTTTTCCTTCAGCTTCATCAACG
CTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAGCGGCAGCCCTTGCGGGGACTGAGTCT
CTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCAAACGGGAGGTGTTGCAGCAACGGGAT
GGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGCAGCAGGACTATGATTTCGAACCGTAC
GCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTGGTGCTGGTCCGGCATCTAATCCTGGT
ACCACATCGAGATATAGTGGGGCCACATCGCCATAA
Transcript >AgabiH97|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGCGGTACACCGCCATTCACTGCTCTC
GTAATAGCGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAATCGGGA
GATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGACCCACC
ACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCAAACAT
GGTCCCGATTTTACTTTCGCAACCACTTTACCACTTTCACAGTGCAAGAATTTTTCCTTCGGTCAGTTGGGTTCT
GCAGTGCAGCCAATATCAGTGCTTGTAACCGTACCTCACGGCGAATCCTTCATGTTGACCGCACCTCTCGGGGAT
CCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCACTGTGAAAGACGCTCAGAACCGCTTG
GGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGTGTTTGGGATCCCCTCCGATATCTGTC
CCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCACAACATATAAATACGTCTTCCAGTAGC
CCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGGTTATTGTCGGCGCCTCTGTCGGTGGA
ACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGACGGAAAGGTGGACGCAATGGCATCAAA
CACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGTATCATGGTCATGTCGCACCCACTCCT
TACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATAATGGTTTTCCTTCAGCTTCATCAACG
CTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAGCGGCAGCCCTTGCGGGGACTGAGTCT
CTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCAAACGGGAGGTGTTGCAGCAACGGGAT
GGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGCAGCAGGACTATGATTTCGAACCGTAC
GCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTGGTGCTGGTCCGGCATCTAATCCTGGT
ACCACATCGAGATATAGTGGGGCCACATCGCCATAA
Gene >AgabiH97|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGTGAGTCATTAGAGCAGAAGACAGCG
CTGCTGTCTTTCTATGATTGACATCAAGAGTCAATCGGGGATTAACTCAGAAATTAATATGCATATTCATTGGCT
TCGCAGGCGGTACACCGCCATTCACTGCTCTCGTAATAGCGGTACGCTTCTTTCAAGTGGATATACTCGTAGACT
GATTGTTAATGCAGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAAT
CGGGAGATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGAC
CCACCACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCA
AACATGGTAGGCTCAAATAATCATGGGGTATATATATTTTGCGAGTCGGGATTTTCGCAGGTCCCGATTTTACTT
TCGCAACCACTTTACCACTTTCACAGTGCAAGTGAGTTCTCCTCCACCTATCTCGCTACGTATTACGGTCTTATT
GGGCATACTTAGGAATTTTTCCTTCGGTCAGTTGGGTTCTGCAGTGCAGCCAATATCAGTGCTTGTTTGTCACAT
CGTACTTTCTTTTTCCGTGGCCGTAGACGCTCATGTTTTTTTTTCTACAGGTAACCGTACCTCACGGCGAATCCT
TCATGTTGACCGCACCTCTCGGGGATCCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCA
CTGTGAAAGACGCTCAGAACCGCTTGGGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGT
GTTTGGGATCCCCTCCGATATCTGTCCCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCAC
AACATATAAATACGTCTTCCAGTAGCCCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGG
TTATTGTCGGCGCCTCTGTCGGTGGAACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGAC
GGAAAGGTGGACGCAATGGCATCAAACACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGT
ATCATGGTCATGTCGCACCCACTCCTTACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATA
ATGGTTTTCCTTCAGCTTCATCAACGCTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAG
CGGCAGCCCTTGCGGGGACTGAGTCTCTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCA
AACGGGAGGTGTTGCAGCAACGGGATGGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGC
AGCAGGACTATGATTTCGAACCGTACGCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTG
GTGCTGGTCCGGCATCTAATCCTGGTACCACATCGAGATATAGTGGGGCCACATCGCCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail