Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010260
Gene name
Locationscaffold_1:2412397..2414102
Strand+
Gene length (bp)1705
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 254 276 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 35.28 20.44 50.13
Initials Initials knots 29.22 16.65 41.80
Pileal_Stipeal_center Stage I stipe center 25.01 13.99 36.03
Pileal_Stipeal_shell Stage I stipe shell 22.95 12.72 33.18
DIF_stipe_center Stage II stipe center 21.45 11.79 31.12
DIF_stipe_shell Stage II stipe shell 22.64 12.51 32.76
DIF_stipe_skin Stage II stipe skin 24.57 13.72 35.42
DIF_cap_skin Stage II cap skin 21.40 11.74 31.07
DIF_cap_tissue Stage II cap tissue 19.70 10.68 28.73
DIF_gill_tissue Stage II gill tissue 23.78 13.17 34.38
YFB_stipe_center Young fruiting body stipe center 19.19 10.40 27.97
YFB_stipe_shell Young fruiting body stipe shell 20.39 11.05 29.73
YFB_stipe_skin Young fruiting body stipe skin 21.51 11.82 31.19
YFB_cap_skin Young fruiting body cap skin 17.77 9.51 26.03
YFB_cap_tissue Young fruiting body cap tissue 18.49 9.98 27.01
YFB_gill_tissue Young fruiting body gill tissue 21.64 11.89 31.39
YFB_veil Young fruiting body veil 22.18 12.25 32.10

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.210195 no
Casing YFB_stipe_center 0.033211 yes
Casing YFB_stipe_shell 0.068640 no
Casing YFB_stipe_skin 0.102187 no
Casing YFB_cap_skin 0.014081 yes
Casing YFB_cap_tissue 0.023415 yes
Casing YFB_gill_tissue 0.101059 no
Casing YFB_veil 0.125429 no
Casing Initials 0.641975 no
Casing Pileal_Stipeal_center 0.289380 no
Casing Pileal_Stipeal_shell 0.162633 no
Casing DIF_stipe_center 0.095314 no
Casing DIF_stipe_shell 0.146063 no
Casing DIF_stipe_skin 0.260392 no
Casing DIF_cap_skin 0.091664 no
Casing DIF_cap_tissue 0.047798 yes
DIF_gill_tissue YFB_stipe_center 0.620391 no
DIF_gill_tissue YFB_stipe_shell 0.751468 no
DIF_gill_tissue YFB_stipe_skin 0.852673 no
DIF_gill_tissue YFB_cap_skin 0.438285 no
DIF_gill_tissue YFB_cap_tissue 0.534082 no
DIF_gill_tissue YFB_gill_tissue 0.860321 no
DIF_gill_tissue YFB_veil 0.900614 no
YFB_stipe_center YFB_stipe_shell 0.920036 no
YFB_stipe_center YFB_stipe_skin 0.830315 no
YFB_stipe_center YFB_cap_skin 0.894002 no
YFB_stipe_center YFB_cap_tissue 0.954207 no
YFB_stipe_center YFB_gill_tissue 0.813591 no
YFB_stipe_center YFB_veil 0.765824 no
YFB_stipe_shell YFB_stipe_skin 0.930026 no
YFB_stipe_shell YFB_cap_skin 0.785046 no
YFB_stipe_shell YFB_cap_tissue 0.862933 no
YFB_stipe_shell YFB_gill_tissue 0.918698 no
YFB_stipe_shell YFB_veil 0.878462 no
YFB_stipe_skin YFB_cap_skin 0.663812 no
YFB_stipe_skin YFB_cap_tissue 0.754255 no
YFB_stipe_skin YFB_gill_tissue 0.991714 no
YFB_stipe_skin YFB_veil 0.960101 no
YFB_cap_skin YFB_cap_tissue 0.948419 no
YFB_cap_skin YFB_gill_tissue 0.655582 no
YFB_cap_skin YFB_veil 0.599375 no
YFB_cap_tissue YFB_gill_tissue 0.738344 no
YFB_cap_tissue YFB_veil 0.684739 no
YFB_gill_tissue YFB_veil 0.967364 no
Initials DIF_gill_tissue 0.615446 no
Initials YFB_stipe_center 0.196632 no
Initials YFB_stipe_shell 0.302886 no
Initials YFB_stipe_skin 0.399362 no
Initials YFB_cap_skin 0.109622 no
Initials YFB_cap_tissue 0.146995 no
Initials YFB_gill_tissue 0.402444 no
Initials YFB_veil 0.456598 no
Initials Pileal_Stipeal_center 0.727807 no
Initials Pileal_Stipeal_shell 0.539132 no
Initials DIF_stipe_center 0.389862 no
Initials DIF_stipe_shell 0.503953 no
Initials DIF_stipe_skin 0.684340 no
Initials DIF_cap_skin 0.378318 no
Initials DIF_cap_tissue 0.230656 no
Pileal_Stipeal_center DIF_gill_tissue 0.930000 no
Pileal_Stipeal_center YFB_stipe_center 0.493038 no
Pileal_Stipeal_center YFB_stipe_shell 0.633782 no
Pileal_Stipeal_center YFB_stipe_skin 0.749646 no
Pileal_Stipeal_center YFB_cap_skin 0.326941 no
Pileal_Stipeal_center YFB_cap_tissue 0.410165 no
Pileal_Stipeal_center YFB_gill_tissue 0.758505 no
Pileal_Stipeal_center YFB_veil 0.805911 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.872465 no
Pileal_Stipeal_center DIF_stipe_center 0.741163 no
Pileal_Stipeal_center DIF_stipe_shell 0.847394 no
Pileal_Stipeal_center DIF_stipe_skin 0.975985 no
Pileal_Stipeal_center DIF_cap_skin 0.734986 no
Pileal_Stipeal_center DIF_cap_tissue 0.557090 no
Pileal_Stipeal_shell DIF_gill_tissue 0.951852 no
Pileal_Stipeal_shell YFB_stipe_center 0.694381 no
Pileal_Stipeal_shell YFB_stipe_shell 0.818139 no
Pileal_Stipeal_shell YFB_stipe_skin 0.907787 no
Pileal_Stipeal_shell YFB_cap_skin 0.520190 no
Pileal_Stipeal_shell YFB_cap_tissue 0.614692 no
Pileal_Stipeal_shell YFB_gill_tissue 0.915232 no
Pileal_Stipeal_shell YFB_veil 0.953410 no
Pileal_Stipeal_shell DIF_stipe_center 0.904295 no
Pileal_Stipeal_shell DIF_stipe_shell 0.980988 no
Pileal_Stipeal_shell DIF_stipe_skin 0.898925 no
Pileal_Stipeal_shell DIF_cap_skin 0.898778 no
Pileal_Stipeal_shell DIF_cap_tissue 0.751198 no
DIF_stipe_center DIF_gill_tissue 0.845475 no
DIF_stipe_center YFB_stipe_center 0.831574 no
DIF_stipe_center YFB_stipe_shell 0.932959 no
DIF_stipe_center YFB_stipe_skin 0.996056 no
DIF_stipe_center YFB_cap_skin 0.669285 no
DIF_stipe_center YFB_cap_tissue 0.761735 no
DIF_stipe_center YFB_gill_tissue 0.988112 no
DIF_stipe_center YFB_veil 0.956969 no
DIF_stipe_center DIF_stipe_shell 0.926914 no
DIF_stipe_center DIF_stipe_skin 0.775666 no
DIF_stipe_center DIF_cap_skin 0.996433 no
DIF_stipe_center DIF_cap_tissue 0.880810 no
DIF_stipe_shell DIF_gill_tissue 0.932700 no
DIF_stipe_shell YFB_stipe_center 0.724478 no
DIF_stipe_shell YFB_stipe_shell 0.845079 no
DIF_stipe_shell YFB_stipe_skin 0.930230 no
DIF_stipe_shell YFB_cap_skin 0.551745 no
DIF_stipe_shell YFB_cap_tissue 0.648446 no
DIF_stipe_shell YFB_gill_tissue 0.937352 no
DIF_stipe_shell YFB_veil 0.973480 no
DIF_stipe_shell DIF_stipe_skin 0.876641 no
DIF_stipe_shell DIF_cap_skin 0.922461 no
DIF_stipe_shell DIF_cap_tissue 0.778800 no
DIF_stipe_skin DIF_gill_tissue 0.957023 no
DIF_stipe_skin YFB_stipe_center 0.535600 no
DIF_stipe_skin YFB_stipe_shell 0.674728 no
DIF_stipe_skin YFB_stipe_skin 0.785200 no
DIF_stipe_skin YFB_cap_skin 0.362895 no
DIF_stipe_skin YFB_cap_tissue 0.454694 no
DIF_stipe_skin YFB_gill_tissue 0.792880 no
DIF_stipe_skin YFB_veil 0.841123 no
DIF_stipe_skin DIF_cap_skin 0.772359 no
DIF_stipe_skin DIF_cap_tissue 0.597930 no
DIF_cap_skin DIF_gill_tissue 0.839383 no
DIF_cap_skin YFB_stipe_center 0.833930 no
DIF_cap_skin YFB_stipe_shell 0.935124 no
DIF_cap_skin YFB_stipe_skin 0.993176 no
DIF_cap_skin YFB_cap_skin 0.676426 no
DIF_cap_skin YFB_cap_tissue 0.766526 no
DIF_cap_skin YFB_gill_tissue 0.984999 no
DIF_cap_skin YFB_veil 0.952649 no
DIF_cap_skin DIF_cap_tissue 0.882669 no
DIF_cap_tissue DIF_gill_tissue 0.675495 no
DIF_cap_tissue YFB_stipe_center 0.965311 no
DIF_cap_tissue YFB_stipe_shell 0.956076 no
DIF_cap_tissue YFB_stipe_skin 0.875444 no
DIF_cap_tissue YFB_cap_skin 0.850122 no
DIF_cap_tissue YFB_cap_tissue 0.916767 no
DIF_cap_tissue YFB_gill_tissue 0.863074 no
DIF_cap_tissue YFB_veil 0.816426 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010260
MCCLDFLLCFFTLAACFHRIYGFPFETSHPTQCGTQIFTWVDGTPPFNALIFVSDGTMRNLSIPADAYDSERAEG
RFSFPLNFNRSQSIMFAMGDATGVTSGGITDVFTVGSASESSPSCNTTDPGVDFFFSTNSKLIQCKDFEFSLFPN
AVQPITILVTVANGESFYLRPPPGDPFVWKANLTSGSSVLFTMTDSRNRVGGTSELNIVGDSDDSSCLRQLSPSA
APTRTPPAPTSTSTPTQTQSDGKRNNIGLIVGASIAGVVAIAIIAVLIYFISKRSSRKGPKAIDLTGGEPDSSTG
LLSFGQQQTRNPAMNPFSSSHDSTITPYSIGSPAGASMMGSNSMGNLSAAAGIGAASGVGAVAAQGRQARMIAKH
EAIQQDTYQTYLDPYNSPYEQSQSAASSSSAYQTTFNSPSGPSSTSTRKSTMESSAQLTPRRFIVHTDIEDEPIE
LPPMYSERTHGSQRS*
Coding >AgabiH97|010260
ATGTGTTGTCTAGACTTTCTTTTATGTTTTTTTACGCTTGCTGCGTGTTTCCACCGTATCTATGGCTTTCCTTTC
GAGACTTCTCATCCGACCCAGTGTGGCACACAGATTTTTACTTGGGTTGATGGCACACCACCGTTTAATGCCCTC
ATATTTGTGTCGGACGGTACTATGCGAAATCTCAGTATTCCAGCGGATGCATACGACTCAGAACGTGCGGAGGGA
AGATTTTCATTTCCTCTGAACTTTAATCGAAGCCAGTCGATTATGTTTGCAATGGGAGATGCAACCGGGGTGACT
TCTGGCGGCATAACGGACGTCTTTACTGTCGGCTCGGCGTCTGAGAGTTCACCAAGTTGTAATACGACTGATCCT
GGCGTAGATTTCTTTTTTTCAACCAATTCTAAGCTCATACAATGCAAAGACTTCGAGTTTTCGCTCTTTCCCAAT
GCAGTGCAACCTATAACAATTCTTGTGACAGTAGCCAATGGAGAATCTTTCTACCTTCGTCCACCTCCGGGCGAT
CCATTTGTTTGGAAAGCCAACCTAACGTCAGGATCATCTGTCCTGTTCACGATGACAGACTCAAGAAATCGCGTG
GGCGGAACATCAGAGCTGAATATTGTAGGGGATTCAGATGATTCATCATGCCTCCGTCAACTTTCTCCGTCGGCT
GCACCAACTCGTACTCCACCGGCACCTACTTCAACATCCACTCCTACTCAGACACAGAGCGATGGAAAGAGGAAC
AACATAGGGTTAATCGTCGGCGCATCTATCGCTGGAGTTGTTGCAATTGCCATTATAGCCGTGCTTATTTACTTC
ATCTCTAAACGGAGTAGTAGAAAGGGACCCAAGGCTATCGATCTGACGGGAGGAGAGCCCGATTCTTCCACTGGT
CTGTTGTCCTTTGGCCAGCAACAGACTCGAAACCCTGCAATGAATCCATTCTCGTCATCCCATGATTCTACAATA
ACGCCATACAGTATCGGTTCACCTGCTGGGGCTTCGATGATGGGTAGTAACAGTATGGGAAACCTTTCAGCCGCC
GCGGGTATCGGGGCAGCTTCGGGAGTTGGAGCCGTGGCCGCTCAGGGCCGTCAAGCGAGAATGATCGCCAAACAT
GAAGCTATACAGCAGGATACATACCAAACATATCTTGATCCTTACAACTCTCCTTACGAACAAAGCCAGTCCGCC
GCATCTTCCAGTTCTGCCTACCAGACAACGTTCAACTCTCCTTCCGGACCCTCATCCACGTCGACCCGGAAGTCA
ACAATGGAGTCGTCCGCACAACTTACTCCACGGCGTTTCATCGTGCATACCGACATCGAAGATGAACCGATAGAA
TTGCCTCCAATGTATTCAGAACGGACGCATGGTTCTCAACGCTCATAA
Transcript >AgabiH97|010260
ATGTGTTGTCTAGACTTTCTTTTATGTTTTTTTACGCTTGCTGCGTGTTTCCACCGTATCTATGGCTTTCCTTTC
GAGACTTCTCATCCGACCCAGTGTGGCACACAGATTTTTACTTGGGTTGATGGCACACCACCGTTTAATGCCCTC
ATATTTGTGTCGGACGGTACTATGCGAAATCTCAGTATTCCAGCGGATGCATACGACTCAGAACGTGCGGAGGGA
AGATTTTCATTTCCTCTGAACTTTAATCGAAGCCAGTCGATTATGTTTGCAATGGGAGATGCAACCGGGGTGACT
TCTGGCGGCATAACGGACGTCTTTACTGTCGGCTCGGCGTCTGAGAGTTCACCAAGTTGTAATACGACTGATCCT
GGCGTAGATTTCTTTTTTTCAACCAATTCTAAGCTCATACAATGCAAAGACTTCGAGTTTTCGCTCTTTCCCAAT
GCAGTGCAACCTATAACAATTCTTGTGACAGTAGCCAATGGAGAATCTTTCTACCTTCGTCCACCTCCGGGCGAT
CCATTTGTTTGGAAAGCCAACCTAACGTCAGGATCATCTGTCCTGTTCACGATGACAGACTCAAGAAATCGCGTG
GGCGGAACATCAGAGCTGAATATTGTAGGGGATTCAGATGATTCATCATGCCTCCGTCAACTTTCTCCGTCGGCT
GCACCAACTCGTACTCCACCGGCACCTACTTCAACATCCACTCCTACTCAGACACAGAGCGATGGAAAGAGGAAC
AACATAGGGTTAATCGTCGGCGCATCTATCGCTGGAGTTGTTGCAATTGCCATTATAGCCGTGCTTATTTACTTC
ATCTCTAAACGGAGTAGTAGAAAGGGACCCAAGGCTATCGATCTGACGGGAGGAGAGCCCGATTCTTCCACTGGT
CTGTTGTCCTTTGGCCAGCAACAGACTCGAAACCCTGCAATGAATCCATTCTCGTCATCCCATGATTCTACAATA
ACGCCATACAGTATCGGTTCACCTGCTGGGGCTTCGATGATGGGTAGTAACAGTATGGGAAACCTTTCAGCCGCC
GCGGGTATCGGGGCAGCTTCGGGAGTTGGAGCCGTGGCCGCTCAGGGCCGTCAAGCGAGAATGATCGCCAAACAT
GAAGCTATACAGCAGGATACATACCAAACATATCTTGATCCTTACAACTCTCCTTACGAACAAAGCCAGTCCGCC
GCATCTTCCAGTTCTGCCTACCAGACAACGTTCAACTCTCCTTCCGGACCCTCATCCACGTCGACCCGGAAGTCA
ACAATGGAGTCGTCCGCACAACTTACTCCACGGCGTTTCATCGTGCATACCGACATCGAAGATGAACCGATAGAA
TTGCCTCCAATGTATTCAGAACGGACGCATGGTTCTCAACGCTCATAA
Gene >AgabiH97|010260
ATGTGTTGTCTAGACTTTCTTTTATGTTTTTTTACGCTTGCTGCGTGTTTCCACCGTATCTATGGCTTTCCTTTC
GAGACTTCTCATCCGACCCAGTGTGGCACACAGATTTTTACTTGGGTTGGTAAGTGCCACCTTGTTACTGATATA
ATCTTGCTTTTCTACAATCTAGATTCTAATGTAAACAAACCATTTTGCAGATGGCACACCACCGTTTAATGCCCT
CATATTTGTGGTGTGTGTTCTTCGCCTTATTTCTATAAACCACACACGGTTGACCAGCGCGCGCGTTGTCATGTC
GTAGTCGGACGGTACTATGCGAAATCTCAGTATTCCAGCGGATGCATACGACTCAGAACGTGCGGAGGGAAGATT
TTCATTTCCTCTGAACTTTAATCGAAGCCAGTCGATTATGTTTGCAATGGGAGATGCAACCGGGGTGACTTCTGG
CGGCATAACGGACGTCTTTACTGTCGGCTCGGCGTCTGAGAGTTCACCAAGTTGTAATACGACTGATCCTGGTGG
GTTAGGAAAAGAGGTTGTGAATTGTATATTGACGATATTCCACAGGCGTAGATTTCTTTTTTTCAACCAATTCTA
AGCTCATACAATGCAAGTGAGTTTCGGCCGATCTACCTCCAATCCCTCAAGGGTGTTCTAACAACCAATCCATCC
AGAGACTTCGAGTTTTCGCTCTTTCCCAATGCAGTGCAACCTATAACAATTCTTGTACGTGACTACTGTATAACT
CTTTACCTTACTGACAATTTCTTTCTTGTAGGTGACAGTAGCCAATGGAGAATCTTTCTACCTTCGTCCACCTCC
GGGCGATCCATTTGTTTGGAAAGCCAACCTAACGTCAGGATCATCTGTCCTGTTCACGATGACAGACTCAAGAAA
TCGCGTGGGCGGAACATCAGAGCTGAATATTGTAGGGGATTCAGATGATTCATCATGCCTCCGTCAACTTTCTCC
GTCGGCTGCACCAACTCGTACTCCACCGGCACCTACTTCAACATCCACTCCTACTCAGACACAGAGCGATGGAAA
GAGGAACAACATAGGGTTAATCGTCGGCGCATCTATCGCTGGAGTTGTTGCAATTGCCATTATAGCCGTGCTTAT
TTACTTCATCTCTAAACGGAGTAGTAGAAAGGGACCCAAGGCTATCGATCTGACGGGAGGAGAGCCCGATTCTTC
CACTGGTCTGTTGTCCTTTGGCCAGCAACAGACTCGAAACCCTGCAATGAATCCATTCTCGTCATCCCATGATTC
TACAATAACGCCATACAGTATCGGTTCACCTGCTGGGGCTTCGATGATGGGTAGTAACAGTATGGGAAACCTTTC
AGCCGCCGCGGGTATCGGGGCAGCTTCGGGAGTTGGAGCCGTGGCCGCTCAGGGCCGTCAAGCGAGAATGATCGC
CAAACATGAAGCTATACAGCAGGATACATACCAAACATATCTTGATCCTTACAACTCTCCTTACGAACAAAGCCA
GTCCGCCGCATCTTCCAGTTCTGCCTACCAGACAACGTTCAACTCTCCTTCCGGACCCTCATCCACGTCGACCCG
GAAGTCAACAATGGAGTCGTCCGCACAACTTACTCCACGGCGTTTCATCGTGCATACCGACATCGAAGATGAACC
GATAGAATTGCCTCCAATGTATTCAGAACGGACGCATGGTTCTCAACGCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail