Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|010170
Gene name
Locationscaffold_1:2396161..2398317
Strand-
Gene length (bp)2156
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 3.8E-34 63 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13681|IINMP_SCHPO Integral inner nuclear membrane protein ima1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=IMA1 PE=4 SV=2 62 388 4.0E-20
sp|A4IG66|TM201_DANRE Transmembrane protein 201 OS=Danio rerio GN=tmem201 PE=2 SV=1 59 215 6.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 244 263 19
2 268 290 22
3 316 338 22
4 358 380 22
5 568 590 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|010170
MVQSCVAVVYRAGWHGFSDVCASSTLHPQKSDQFTTLQVDITSQSQSHPQHMSHLFRRHSNILCFFCQTPVSSLP
KDIRNFKCPTCACWNKYDANGEIISDEPAMYDENLNKDSFAKRASPRRDRFPTSYGPGPFCHTCQTNQMLLMNLL
SSYLPPPEHPDYAQRLEMFPEYKESLHMRYPPVCESCMPGVEDEIRRKDQMARAKALGASLRNSRGKENKRRVPG
KGRVREKETTEFYWWKIRGGLWFTTSTVSFMFNATAALGYRPFYLLGSIQPVLPLFVLVTIFWTVWDPTYASFRR
AQKQGRDVRVIGKKEYIVLQMIVWITRLLTSVLFWLWWYSPKNNHFELYDPSSQLARIYFSTITTIELTAQGLSF
SCLRLKHPPTVRLIDTRTHLSTPSRSSTPYSSGSMSHGETSLTSQPSTSICSTPIEPDLSVLSLSSKPVMTHKKP
VFGLPSLLSNLPTQKGQEHGHQDIDIDPNDGDGDDENAMDWTPTDPRIAARRKRKNGQLRDDVYLRPPKFFAPEQ
PTGLESLFARTSIDDDVMMLDGQDDSGGGRLFFRKVGRYFKRWSLICATVIVPVLVAVLVRRAWNLDINVTSLQK
GQVVVRMSSPSPFPLDCRVEVDEFA*
Coding >AgabiH97|010170
ATGGTGCAGAGCTGTGTAGCTGTAGTCTATCGCGCAGGCTGGCATGGATTTTCCGATGTCTGCGCCTCTTCGACC
CTCCACCCACAGAAGAGTGATCAGTTTACCACGCTCCAAGTTGATATCACATCCCAGTCCCAGTCTCACCCCCAA
CACATGTCACACTTGTTCCGGCGACATAGCAATATCCTCTGCTTCTTCTGCCAAACTCCAGTCTCATCCCTACCC
AAGGATATACGTAACTTCAAATGCCCCACCTGTGCCTGCTGGAACAAATACGATGCGAACGGCGAAATAATCTCC
GACGAACCCGCGATGTACGATGAAAATCTCAACAAGGACTCCTTTGCGAAGCGGGCGTCACCACGAAGAGACCGA
TTTCCAACTTCCTACGGACCAGGCCCATTTTGTCATACATGCCAGACAAACCAAATGCTTCTTATGAACCTACTT
TCGTCCTATCTTCCTCCCCCTGAGCACCCCGATTATGCCCAACGCCTTGAAATGTTCCCTGAATACAAGGAATCC
CTACATATGCGATACCCGCCTGTCTGTGAGAGCTGTATGCCCGGTGTCGAGGACGAGATCCGAAGGAAAGACCAG
ATGGCTCGTGCAAAGGCTCTGGGCGCATCGCTGAGGAATAGCAGAGGAAAGGAGAATAAAAGGAGGGTGCCTGGA
AAGGGCAGAGTTCGCGAGAAAGAGACGACCGAATTCTATTGGTGGAAAATACGTGGGGGTCTCTGGTTCACAACA
TCTACAGTATCTTTCATGTTCAACGCAACAGCCGCTCTTGGCTATAGACCTTTCTATCTCCTCGGATCAATACAG
CCCGTTCTTCCTCTCTTTGTTCTGGTGACCATTTTCTGGACGGTATGGGATCCAACGTACGCCTCCTTTCGGAGG
GCTCAAAAACAGGGACGTGACGTCCGTGTCATTGGAAAGAAAGAGTACATTGTATTGCAAATGATTGTATGGATC
ACAAGATTACTTACAAGTGTACTATTCTGGCTCTGGTGGTACAGTCCCAAGAACAATCATTTTGAACTTTACGAC
CCTTCTTCACAACTAGCACGCATCTATTTCTCCACAATAACAACTATTGAACTCACCGCACAAGGATTATCTTTT
TCTTGTCTCCGACTCAAGCATCCTCCTACTGTTCGCCTCATTGACACTCGCACGCATCTTTCCACACCTTCTCGC
TCATCTACACCCTATTCATCAGGCTCCATGAGCCACGGCGAGACCAGTTTAACTTCTCAGCCATCTACAAGTATT
TGTTCAACGCCCATCGAACCTGATTTATCCGTTCTTTCGCTCTCTTCCAAACCAGTCATGACACACAAGAAACCC
GTGTTTGGTTTACCCTCTCTTTTATCTAATCTACCGACTCAAAAAGGACAAGAACATGGACATCAAGATATTGAT
ATTGATCCTAATGATGGGGATGGGGACGATGAAAATGCTATGGATTGGACGCCAACCGATCCTCGAATAGCGGCT
CGACGGAAACGGAAGAATGGACAGCTACGCGATGATGTGTATCTTCGGCCACCAAAGTTTTTCGCACCTGAACAG
CCAACTGGATTAGAGAGCTTGTTTGCAAGGACGAGTATTGATGACGACGTGATGATGCTAGACGGTCAAGACGAC
TCTGGTGGTGGAAGATTATTCTTTAGAAAAGTTGGAAGATATTTTAAGAGGTGGTCGTTGATCTGTGCGACGGTC
ATCGTCCCGGTACTGGTTGCAGTGCTGGTTAGGAGAGCATGGAACTTGGATATCAACGTGACGTCACTCCAGAAA
GGGCAAGTTGTTGTCAGGATGTCTTCGCCTTCGCCGTTTCCTCTTGACTGTCGTGTTGAGGTGGATGAATTTGCT
TGA
Transcript >AgabiH97|010170
ATGGTGCAGAGCTGTGTAGCTGTAGTCTATCGCGCAGGCTGGCATGGATTTTCCGATGTCTGCGCCTCTTCGACC
CTCCACCCACAGAAGAGTGATCAGTTTACCACGCTCCAAGTTGATATCACATCCCAGTCCCAGTCTCACCCCCAA
CACATGTCACACTTGTTCCGGCGACATAGCAATATCCTCTGCTTCTTCTGCCAAACTCCAGTCTCATCCCTACCC
AAGGATATACGTAACTTCAAATGCCCCACCTGTGCCTGCTGGAACAAATACGATGCGAACGGCGAAATAATCTCC
GACGAACCCGCGATGTACGATGAAAATCTCAACAAGGACTCCTTTGCGAAGCGGGCGTCACCACGAAGAGACCGA
TTTCCAACTTCCTACGGACCAGGCCCATTTTGTCATACATGCCAGACAAACCAAATGCTTCTTATGAACCTACTT
TCGTCCTATCTTCCTCCCCCTGAGCACCCCGATTATGCCCAACGCCTTGAAATGTTCCCTGAATACAAGGAATCC
CTACATATGCGATACCCGCCTGTCTGTGAGAGCTGTATGCCCGGTGTCGAGGACGAGATCCGAAGGAAAGACCAG
ATGGCTCGTGCAAAGGCTCTGGGCGCATCGCTGAGGAATAGCAGAGGAAAGGAGAATAAAAGGAGGGTGCCTGGA
AAGGGCAGAGTTCGCGAGAAAGAGACGACCGAATTCTATTGGTGGAAAATACGTGGGGGTCTCTGGTTCACAACA
TCTACAGTATCTTTCATGTTCAACGCAACAGCCGCTCTTGGCTATAGACCTTTCTATCTCCTCGGATCAATACAG
CCCGTTCTTCCTCTCTTTGTTCTGGTGACCATTTTCTGGACGGTATGGGATCCAACGTACGCCTCCTTTCGGAGG
GCTCAAAAACAGGGACGTGACGTCCGTGTCATTGGAAAGAAAGAGTACATTGTATTGCAAATGATTGTATGGATC
ACAAGATTACTTACAAGTGTACTATTCTGGCTCTGGTGGTACAGTCCCAAGAACAATCATTTTGAACTTTACGAC
CCTTCTTCACAACTAGCACGCATCTATTTCTCCACAATAACAACTATTGAACTCACCGCACAAGGATTATCTTTT
TCTTGTCTCCGACTCAAGCATCCTCCTACTGTTCGCCTCATTGACACTCGCACGCATCTTTCCACACCTTCTCGC
TCATCTACACCCTATTCATCAGGCTCCATGAGCCACGGCGAGACCAGTTTAACTTCTCAGCCATCTACAAGTATT
TGTTCAACGCCCATCGAACCTGATTTATCCGTTCTTTCGCTCTCTTCCAAACCAGTCATGACACACAAGAAACCC
GTGTTTGGTTTACCCTCTCTTTTATCTAATCTACCGACTCAAAAAGGACAAGAACATGGACATCAAGATATTGAT
ATTGATCCTAATGATGGGGATGGGGACGATGAAAATGCTATGGATTGGACGCCAACCGATCCTCGAATAGCGGCT
CGACGGAAACGGAAGAATGGACAGCTACGCGATGATGTGTATCTTCGGCCACCAAAGTTTTTCGCACCTGAACAG
CCAACTGGATTAGAGAGCTTGTTTGCAAGGACGAGTATTGATGACGACGTGATGATGCTAGACGGTCAAGACGAC
TCTGGTGGTGGAAGATTATTCTTTAGAAAAGTTGGAAGATATTTTAAGAGGTGGTCGTTGATCTGTGCGACGGTC
ATCGTCCCGGTACTGGTTGCAGTGCTGGTTAGGAGAGCATGGAACTTGGATATCAACGTGACGTCACTCCAGAAA
GGGCAAGTTGTTGTCAGGATGTCTTCGCCTTCGCCGTTTCCTCTTGACTGTCGTGTTGAGGTGGATGAATTTGCT
TGA
Gene >AgabiH97|010170
ATGGTGCAGAGCTGTGTAGCTGTAGTCTATCGCGCAGGCTGGCATGGATTTTCCGATGTCTGCGCCTCTTCGACC
CTCCACCCACAGAAGAGTGATCAGTTTACCACGCTCCAAGTTGATATCACATCCCAGTCCCAGTCTCACCCCCAA
CACATGTCACACTTGTTCCGGCGACATAGCAATATCCTCTGCTTCTTCTGCCAAACTCCAGTCTCATCCCTACCC
AAGGATATACGTAACTTCAAATGCCCCACCTGTGCCTGCTGGAACAAATACGATGCGAACGGCGAAATAATCTCC
GACGAACCCGCGATGTACGATGAAAATCTCAACAAGGACTCCTTTGCGAAGCGGGGTACGTTCAGGAGCGTATGC
CTCAAGACCCAACTAACGTTTATCGCAGCGTCACCACGAAGAGACCGATTTCCAACTTCCTACGGACCAGGCCCA
TTTTGTCATACATGCCAGACAAACCAAATGCTTCTTATGAACCTACTTTCGTCCTATCTTCCTCCCCCTGAGGTG
TGCCGTTTTCCCAACTATCTCACTTTCCACCTACTCAAATGTACATCGCATTACATAGCACCCCGATTATGCCCA
ACGCCTTGAAATGTTCCCTGAATACAAGGAATCCCTACATATGCGATACCCGCCTGTCTGTGAGAGCTGTATGCC
CGGTGTCGAGGACGAGATCCGAAGGAAAGACCAGATGGCTCGTGCAAAGGCTCTGGGCGCATCGCTGAGGAATAG
CAGAGGAAAGGAGAATAAAAGGAGGGTGCCTGGAAAGGGCAGAGTTCGCGAGAAAGAGACGACCGAATTCTATTG
GTGGAAAATACGTGGGGGTCTCTGGTTCACAACATCTACAGTATCTTTCATGTTCAACGCAACAGGTACGTGGCC
ATTTAACTGCCTACTCACAATTCGCTCGGTTCTAACTCTTCATAAGCCGCTCTTGGCTATAGACCTTTCTATCTC
CTCGGATCAATACAGCCCGTTCTTCCTCTCTTTGTTCTGGTGACCATTTTCTGGACGGTATGGGATCCAACGTAC
GCCTCCTTTCGGAGGGCTCAAAAACAGGGACGTGACGTCCGTGTCATTGGAAAGAAAGAGTACATTGTAAGTCGG
TCCTCTCAGTCCTCGTGTTAATATTGATTGAAGCATTTTCTGTTAGGTATTGCAAATGATTGTATGGATCACAAG
ATTACTTACAAGTGTACTATTCTGGCTCTGGTGGTACAGTCCCAAGAACAATCATTTTGAACTTTACGACCCTTC
TTCACAACTAGCACGCATCTATTTCTCCACAATAACAACTATTGAACTCACCGTGAGTCTCTCCGAAACTGAATC
TAAAACGAAACATGAGCTGACGGGCTGTGTCTTAGGCACAAGGATTATCTTTTTCTTGTCTCCGACTCAAGCATC
CTCCTACTGTTCGCCTCATTGACACTCGCACGCATCTTTCCACACCTTCTCGCTCATCTACACCCTATTCATCAG
GCTCCATGAGCCACGGCGAGACCAGTTTAACTTCTCAGCCATCTACAAGTATTTGTTCAACGCCCATCGAACCTG
ATTTATCCGTTCTTTCGCTCTCTTCCAAACCAGTCATGACACACAAGAAACCCGTGTTTGGTTTACCCTCTCTTT
TATCTAATCTACCGACTCAAAAAGGACAAGAACATGGACATCAAGATATTGATATTGATCCTAATGATGGGGATG
GGGACGATGAAAATGCTATGGATTGGACGCCAACCGATCCTCGAATAGCGGCTCGACGGAAACGGAAGAATGGAC
AGCTACGCGATGATGTGTATCTTCGGCCACCAAAGTTTTTCGCACCTGAACAGCCAACTGGATTAGAGAGCTTGT
TTGCAAGGACGAGTATTGATGACGACGTGATGATGCTAGACGGTCAAGACGACTCTGGTGGTGGAAGATTATTCT
TTAGAAAAGTTGGAAGATATTTTAAGAGGTGGTCGTTGATCTGTGCGACGGTCATCGTCCCGGTACTGGTTGCAG
TGCTGGTTAGGAGAGCATGGAACTTGGATATCAACGTGACGTCACTCCAGAAAGGGCAAGTTGTTGTCAGGATGT
CTTCGCCTTCGCCGTTTCCTCTTGACTGTCGTGTTGAGGTGGATGAATTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail