Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009850
Gene name
Locationscaffold_1:2326817..2327921
Strand+
Gene length (bp)1104
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.5E-40 10 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 8 211 3.0E-42
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 7 174 2.0E-15
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 7 174 5.0E-15
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 7 203 6.0E-15
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 7 203 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 8 211 3.0E-42
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 7 174 2.0E-15
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 7 174 5.0E-15
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 7 203 6.0E-15
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 7 203 6.0E-15
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 7 203 8.0E-15
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 7 203 3.0E-14
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 7 168 4.0E-14
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 7 205 6.0E-14
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 7 205 4.0E-13
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 189 5.0E-13
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 7 205 6.0E-13
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 7 194 6.0E-13
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 7 205 2.0E-12
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 7 205 3.0E-12
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 7 203 3.0E-12
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 7 203 8.0E-12
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 7 203 9.0E-12
sp|Q9FNJ9|CA1P_ARATH Probable 2-carboxy-D-arabinitol-1-phosphatase OS=Arabidopsis thaliana GN=At5g22620 PE=1 SV=1 9 201 1.0E-11
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 7 203 4.0E-11
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 7 202 6.0E-11
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 7 203 1.0E-10
sp|B7KIT8|GPMA_CYAP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmA PE=3 SV=1 7 177 1.0E-10
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 7 203 2.0E-10
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 10 174 3.0E-10
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 7 203 7.0E-10
sp|Q98DM0|GPMA_RHILO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium loti (strain MAFF303099) GN=gpmA PE=3 SV=1 10 138 8.0E-10
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 7 195 9.0E-10
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 7 188 2.0E-09
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 10 174 2.0E-09
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 9 195 2.0E-09
sp|W5EP13|CA1P_WHEAT 2-carboxy-D-arabinitol-1-phosphatase OS=Triticum aestivum PE=1 SV=1 9 215 3.0E-09
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 10 174 3.0E-09
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 7 203 4.0E-09
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 10 174 4.0E-09
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 7 194 4.0E-09
sp|Q2G373|GPMA_NOVAD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gpmA PE=3 SV=1 7 205 2.0E-08
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 9 195 2.0E-08
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 7 174 3.0E-08
sp|Q1GP88|GPMA_SPHAL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gpmA PE=3 SV=1 7 194 5.0E-08
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 7 194 6.0E-08
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 7 174 7.0E-08
sp|A5VB15|GPMA_SPHWW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gpmA PE=3 SV=1 7 194 8.0E-08
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 10 174 1.0E-07
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 10 137 1.0E-07
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 7 174 2.0E-07
sp|P58652|COBC_SALTI Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhi GN=cobC PE=3 SV=1 9 195 2.0E-07
sp|Q38Z74|GPMA2_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA2 PE=3 SV=1 7 114 2.0E-07
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 10 138 3.0E-07
sp|Q9A634|GPMA_CAUCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpmA PE=3 SV=1 7 114 3.0E-07
sp|B8GYN6|GPMA_CAUCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gpmA PE=3 SV=1 7 114 3.0E-07
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 8 181 4.0E-07
sp|B6IYD3|GPMA_RHOCS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gpmA PE=3 SV=1 7 210 5.0E-07
sp|Q49ZZ2|GPMA_STAS1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmA PE=3 SV=1 7 174 6.0E-07
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 7 110 6.0E-07
sp|Q97FJ6|GPMA_CLOAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmA PE=3 SV=1 7 209 6.0E-07
sp|Q74CR0|GPMA_GEOSL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmA PE=3 SV=1 7 114 6.0E-07
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 7 114 6.0E-07
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|A1WDX2|GPMA_VEREI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Verminephrobacter eiseniae (strain EF01-2) GN=gpmA PE=3 SV=1 7 175 7.0E-07
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 10 138 7.0E-07
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 10 138 7.0E-07
sp|Q6NJL2|GPMA_CORDI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpmA PE=3 SV=2 9 194 8.0E-07
sp|Q2N682|GPMA_ERYLH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Erythrobacter litoralis (strain HTCC2594) GN=gpmA PE=3 SV=1 7 114 8.0E-07
sp|C4LLD4|GPMA_CORK4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpmA PE=3 SV=1 9 174 8.0E-07
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 7 114 9.0E-07
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 9 110 9.0E-07
sp|B9L9H5|GPMA_NAUPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=gpmA PE=3 SV=1 7 194 9.0E-07
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 10 174 9.0E-07
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 7 203 1.0E-06
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 10 174 1.0E-06
sp|A4SDM0|GPMA_CHLPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gpmA PE=3 SV=1 7 209 1.0E-06
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 10 174 1.0E-06
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 9 114 1.0E-06
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 9 114 1.0E-06
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 9 110 2.0E-06
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 10 175 2.0E-06
sp|A9M1A2|GPMA_NEIM0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gpmA PE=3 SV=1 10 114 2.0E-06
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 10 177 2.0E-06
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 10 174 2.0E-06
sp|A8IGZ9|GPMA_AZOC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpmA PE=3 SV=1 7 138 2.0E-06
sp|B3PXK3|GPMA_RHIE6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CIAT 652) GN=gpmA PE=3 SV=1 10 138 2.0E-06
sp|Q0C678|GPMA_HYPNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gpmA PE=3 SV=1 7 215 2.0E-06
sp|A1KV25|GPMA_NEIMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gpmA PE=3 SV=1 10 114 2.0E-06
sp|B7GUR7|GPMA_BIFLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gpmA PE=3 SV=1 9 175 3.0E-06
sp|P59159|GPMA_BIFLO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain NCC 2705) GN=gpmA PE=3 SV=1 9 175 3.0E-06
sp|B3DQI6|GPMA_BIFLD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain DJO10A) GN=gpmA PE=3 SV=1 9 175 3.0E-06
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 7 174 3.0E-06
sp|Q9JYF7|GPMA_NEIMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gpmA PE=3 SV=1 10 114 3.0E-06
sp|B8GFF8|GPMA_METPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=gpmA PE=3 SV=1 7 194 3.0E-06
sp|Q6MJP3|GPMA_BDEBA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gpmA PE=3 SV=1 7 114 3.0E-06
sp|Q63B92|GPMA_BACCZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmA PE=3 SV=1 7 114 3.0E-06
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 7 203 3.0E-06
sp|P64956|Y2253_MYCBO Uncharacterized protein Mb2253c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2253c PE=3 SV=1 9 116 3.0E-06
sp|P9WLH5|Y2228_MYCTU Uncharacterized protein Rv2228c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2228c PE=1 SV=1 9 116 3.0E-06
sp|P9WLH4|Y2228_MYCTO Uncharacterized protein MT2287 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2287 PE=3 SV=1 9 116 3.0E-06
sp|B4RIY7|GPMA_NEIG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gpmA PE=3 SV=1 10 114 3.0E-06
sp|Q5F7C0|GPMA_NEIG1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gpmA PE=3 SV=1 10 114 3.0E-06
sp|Q6HIL9|GPMA_BACHK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|B0SY17|GPMA_CAUSK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter sp. (strain K31) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 9 174 4.0E-06
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 7 114 4.0E-06
sp|Q39V40|GPMA_GEOMG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|Q8KFC8|GPMA_CHLTE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gpmA PE=3 SV=1 7 174 4.0E-06
sp|B9J102|GPMA_BACCQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain Q1) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|B7HS46|GPMA_BACC7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH187) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 9 174 5.0E-06
sp|C1EUQ5|GPMA_BACC3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain 03BB102) GN=gpmA PE=3 SV=1 7 114 5.0E-06
sp|A0RE96|GPMA_BACAH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmA PE=3 SV=1 7 114 5.0E-06
sp|B5Y7Q7|GPMA_COPPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gpmA PE=3 SV=1 7 114 5.0E-06
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 1 218 6.0E-06
sp|Q3AU60|GPMA_CHLCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) GN=gpmA PE=3 SV=1 7 175 6.0E-06
sp|Q9JTF2|GPMA_NEIMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gpmA PE=3 SV=1 10 114 6.0E-06
sp|B1GZZ1|GPMA_UNCTG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gpmA PE=3 SV=1 7 175 6.0E-06
sp|B5ZWT2|GPMA_RHILW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpmA PE=3 SV=1 10 138 6.0E-06
sp|Q732Z5|GPMA2_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA2 PE=3 SV=1 7 110 6.0E-06
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 7 114 7.0E-06
sp|A5EV29|GPMA_DICNV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Dichelobacter nodosus (strain VCS1703A) GN=gpmA PE=3 SV=1 7 110 7.0E-06
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 10 194 7.0E-06
sp|Q21CH5|GPMA_RHOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisB18) GN=gpmA PE=3 SV=1 10 174 7.0E-06
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 10 174 8.0E-06
sp|B4SEI0|GPMA_PELPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gpmA PE=3 SV=1 7 175 8.0E-06
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 10 174 8.0E-06
sp|Q01YD0|GPMA_SOLUE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Solibacter usitatus (strain Ellin6076) GN=gpmA PE=3 SV=1 7 110 8.0E-06
sp|Q82TU0|GPMA2_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA2 PE=3 SV=1 7 174 9.0E-06
sp|B3QPN8|GPMA_CHLP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gpmA PE=3 SV=1 7 114 9.0E-06
sp|A9IFJ0|GPMA_BORPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gpmA PE=3 SV=1 7 174 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009850
MSLHRPMPRLFVVRHGQTEWSENGRHTGLSDIPLTAKGEAQVQATAAKLVGDGHLIDPKNLCTVYVSPRQRAHKT
FHILFENVPKVPRHVLTEEAREWDYGEFEGLRTAEILERSPGWNGWTDGYPGGESVEELQSRVDSVIEKVRAYHR
QYYEEGTVSRDVMIVAHGHFGRVLTARWVGFPAAYGTKLTIDAGSITLLSYEHHNLAEPSITALNLSSLLLL*
Coding >AgabiH97|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGACAGACAGAGTGGTCTGAAAATGGGAGA
CATACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGCTCAAGTCCAGGCAACAGCCGCTAAGCTCGTC
GGCGATGGACACCTGATTGACCCGAAGAATCTATGTACCGTCTATGTATCCCCGAGGCAAAGAGCCCACAAGACG
TTCCACATCCTGTTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGACTAC
GGGGAATTTGAAGGTCTCCGGACGGCAGAGATCCTCGAGAGGAGTCCTGGATGGAATGGCTGGACGGATGGGTAC
CCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATAGCGTCATAGAAAAGGTCCGCGCATACCATCGG
CAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCGTCGCCCACGGACATTTTGGAAGAGTATTAACC
GCTCGTTGGGTCGGGTTCCCCGCGGCATACGGCACAAAGCTAACTATAGATGCTGGTTCTATCACACTCCTGAGC
TACGAGCATCATAATCTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG
Transcript >AgabiH97|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGACAGACAGAGTGGTCTGAAAATGGGAGA
CATACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGCTCAAGTCCAGGCAACAGCCGCTAAGCTCGTC
GGCGATGGACACCTGATTGACCCGAAGAATCTATGTACCGTCTATGTATCCCCGAGGCAAAGAGCCCACAAGACG
TTCCACATCCTGTTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGACTAC
GGGGAATTTGAAGGTCTCCGGACGGCAGAGATCCTCGAGAGGAGTCCTGGATGGAATGGCTGGACGGATGGGTAC
CCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATAGCGTCATAGAAAAGGTCCGCGCATACCATCGG
CAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCGTCGCCCACGGACATTTTGGAAGAGTATTAACC
GCTCGTTGGGTCGGGTTCCCCGCGGCATACGGCACAAAGCTAACTATAGATGCTGGTTCTATCACACTCCTGAGC
TACGAGCATCATAATCTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG
Gene >AgabiH97|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGTAAGTTTCCGCAAGATTCAGGCTTATGT
TCTATCATCTCATTTCCGGACAGGACAGACAGAGTGGTCTGAAAATGGGTGAGTCGTTTCTGATCGGGGTTCTTT
GCTCGGTCAACATTGAACGTCTGTTCTTGTAACCAGGAGACATGTGGGTCACTCTTCTCTGTCCATGAAAGCCAC
AAGTAACTCATGAGTATTTTGGTCTTTGGCGTAGACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGC
TCAAGTCCAGGCAACAGCCGCTAAGCTCGTCGGCGATGGACGTATGTGTTCAGGCGATGGGAAATATATTTACTC
TAACGCACACATAGACCTGATTGACCCGAAGAATCTATGTACCGTCTATGTATCCCCGAGGCAAAGAGCCCACAA
GACGTTCCACATCCTGTTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGA
CTACGGTAAGACCCGTGCAGTTCTTCGTTTCCACTGCCATATCATAGCCAAATTATAGGGGAATTTGAAGGTCTC
CGGACGGCAGAGATCCTCGAGAGGAGTCCTGGATGGAATGGCTGGACGGATGGGTAAGAACTGCAGCACCGCCGG
CGATCGAACAGCGTCTGATGTTGATAAGGTACCCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATA
GCGTCATAGAAAAGGTCCGCGCATACCATCGGCAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCG
TCGCCCACGGACATTTTGGAAGAGTATTAACCGCTCGTTGGGTCGGGTTCCCCGCGGCATACGGTAGGAGCCTGT
GATACCATTTTGTGGCACATTTAACATTATGAGAATAGGCACAAAGCTAACTATAGATGCTGGTTCTGTAAGTAA
TTGTCATGGGCATATATGCAAAGACCAGGTTGCTGACTTTGATAGATCACACTCCTGAGCTACGAGCATCATAAT
CTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail