Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009840
Gene name
Locationscaffold_1:2322400..2326222
Strand-
Gene length (bp)3822
Transcript length (bp)3357
Coding sequence length (bp)3357
Protein length (aa) 1119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05131 Pep3_Vps18 Pep3/Vps18/deep orange family 3.5E-51 316 462
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 7.5E-07 841 938

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 61 972 1.0E-173
sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 61 973 1.0E-158
sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 36 978 8.0E-157
sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 36 940 1.0E-120
sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 122 968 3.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 61 972 1.0E-173
sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 61 973 1.0E-158
sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 36 978 8.0E-157
sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 36 940 1.0E-120
sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 122 968 3.0E-95
sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP3 PE=1 SV=1 309 943 1.0E-69
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 571 939 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009840
MFDEYVEHATTGGASAPGALPLPQIEYQGFEPSPYEPNDPRTDIDELAQINAAGSNDPPAPIFELGRVQFAFPAP
LVSFAVSSDLLVMGLNNNLLVLIELSHADQVIKIPINRKPTEMTLHKLFVDPSGRHVIITSMQGENWYLYRNWKK
PRMLKGFKMVIESVAWNKAALLSSTHSTSTKEILIGARNGTIYEAVLDAEEDLFKSQERYLQSVFSLPERHPITG
IKFDYFNPVDGRKALVVVTTTTRIYQFVGSVDKKSEVGKVFSQLFATYREAAPKILELPGDIQHSDLQYFVPNAD
QAHSVPKRMAWMTAAGIYHGSLKIDTEAEDHIDNAQLLPYPTLTGLGTGDLPLSLALTEFHFLALYKDRVVGICN
LNDHVAYEEQLPVKASEAILGMASDPVRRTYWIFTDQSLFEIVVGNEDRDVWKLYLEKGQFETALLFSKTAFQRD
QVLSAQAEAYFNEGRYFQAAGCYAQCSATFEEVVLKFLDAGERDALRSYLITRLERTKKTDLTQRMMLATWLVEF
YLSKCNELDDIVAAESVSHDVDNLQTERVILEDDLRQFFETYRNNLDKETVYELIQGHGRTDMYLYFASAVGDHG
RVAEHWVLEEQWSRAIEVISSQNDLELYYRYASVLMRHAPKDTVDSWLRQPSLDPRRLVPALLQLQHAPRHPLSP
NQAIRYLNFVIFEQLNTSPTIHNLLITFYVSPSSSTYIGTSPSSPRSPTSQLPEDEGPLLRFLSNAPCDPITNKP
YYDLDYALRICKLAGCTNPCVHIYAKMGLYENSVDLALEKGDLELAKINADRVPEEEDQVLRKKLWLKIAKYVVQ
DKKDIKTAMQFLENTDLLKIEDILPFFPDFVVIDDFKEEIAHALEEYSAHIDELKSEMDDATKTAENIKQDIVAL
KNRYITINSNALCSKCEKLLFTRQFYVFPCHHVFHADCLIGMVKENLPPHSLRKIIALQTELTKEAPSTPSKIHA
NDGISKPSVLPGNVHPSRQPTTQRTLLSANFGNIAGMAVAPLKGSAQAANLLGRSVITAGDKLRDLIVPDALATI
ITSPIWIPGMGGGQGKRGLDKDLGKKVEKLRTELEDILASSCPLCESVIVGLDRPFVREGEADASWVL*
Coding >AgabiH97|009840
ATGTTCGACGAATATGTCGAGCATGCTACGACAGGTGGTGCCTCGGCCCCAGGAGCCCTTCCGCTGCCGCAAATC
GAATATCAAGGATTCGAACCATCTCCCTACGAACCTAACGACCCTCGTACGGACATTGACGAACTTGCTCAAATA
AATGCCGCAGGCTCCAATGACCCGCCCGCACCCATCTTTGAACTCGGTCGCGTTCAATTCGCATTTCCCGCTCCC
CTCGTCTCCTTTGCCGTCAGCTCAGACTTATTGGTCATGGGTCTTAACAACAATCTCCTTGTCCTTATTGAGCTC
TCGCATGCCGATCAAGTAATCAAAATTCCAATAAATCGCAAACCTACGGAAATGACATTGCATAAACTCTTCGTG
GATCCTTCTGGGAGGCATGTAATCATCACTTCAATGCAGGGCGAGAACTGGTACCTATACCGGAATTGGAAGAAA
CCTCGAATGCTGAAAGGATTCAAAATGGTCATCGAGAGTGTCGCTTGGAATAAGGCTGCTTTATTGTCCTCCACG
CACTCGACGTCAACTAAGGAAATTCTCATCGGTGCAAGGAATGGGACGATATATGAAGCGGTTTTGGATGCCGAA
GAGGATTTGTTCAAGTCTCAAGAGCGGTATCTGCAGTCTGTGTTCTCGTTACCCGAGAGGCATCCCATCACGGGC
ATTAAATTTGATTATTTTAACCCTGTGGATGGAAGGAAAGCGCTAGTCGTTGTGACAACCACGACAAGAATATAT
CAATTTGTGGGTTCTGTGGATAAAAAGTCGGAGGTTGGCAAGGTGTTTTCGCAGTTGTTTGCTACTTACAGGGAA
GCGGCTCCAAAAATCCTCGAGCTACCGGGAGATATCCAGCATTCCGACCTTCAGTATTTCGTACCGAATGCAGAC
CAAGCTCATTCTGTTCCAAAACGAATGGCATGGATGACCGCTGCCGGGATTTATCATGGCTCCCTCAAGATTGAC
ACGGAGGCGGAAGATCATATCGATAACGCGCAACTTTTGCCATACCCCACTCTCACTGGTCTAGGGACAGGTGAT
CTGCCATTGTCGTTGGCCTTGACGGAATTCCACTTTCTTGCGCTGTACAAGGATCGAGTCGTTGGTATCTGCAAC
CTAAATGATCATGTGGCATACGAGGAACAACTGCCTGTTAAAGCGAGTGAAGCCATTCTTGGGATGGCATCAGAT
CCTGTACGTCGGACCTATTGGATCTTCACGGATCAGTCTCTTTTCGAAATTGTCGTCGGAAATGAGGATCGCGAT
GTATGGAAACTGTACCTTGAGAAAGGTCAATTTGAGACTGCCCTTCTTTTTTCAAAGACAGCATTCCAGCGTGAT
CAGGTTCTTTCTGCCCAAGCTGAAGCCTACTTCAACGAAGGGAGATATTTTCAAGCAGCTGGATGCTATGCACAA
TGCTCGGCTACGTTCGAAGAGGTTGTACTCAAGTTCCTGGATGCTGGGGAACGTGATGCCCTCCGGTCGTATCTC
ATCACACGGTTGGAGCGTACTAAGAAAACGGACCTTACCCAAAGGATGATGCTGGCAACATGGCTAGTGGAATTT
TATCTGAGCAAATGCAACGAGCTGGATGACATCGTTGCGGCAGAGTCTGTTTCGCATGATGTTGATAATTTGCAA
ACTGAGAGGGTCATACTTGAAGATGACTTGCGTCAGTTCTTCGAAACATATAGAAACAATCTGGACAAAGAGACT
GTCTATGAACTTATACAGGGTCATGGACGAACAGATATGTATCTTTATTTTGCATCAGCCGTCGGCGACCATGGT
CGCGTAGCAGAACATTGGGTATTGGAAGAGCAGTGGTCTAGAGCTATCGAAGTTATCAGCAGCCAAAACGACCTC
GAGCTCTATTACCGTTACGCCTCCGTGCTTATGCGACATGCACCGAAAGACACCGTTGACTCTTGGCTTCGTCAA
CCTTCTCTTGATCCACGACGCCTTGTTCCGGCCCTTTTACAATTGCAACATGCACCCCGCCATCCTCTCTCCCCA
AACCAAGCTATTCGCTACCTCAATTTTGTCATTTTTGAACAACTTAATACCTCGCCTACGATACATAATCTACTC
ATAACCTTTTACGTTTCCCCCTCGTCGTCGACATACATTGGCACAAGCCCTTCATCACCAAGGTCGCCTACGTCA
CAACTTCCCGAAGACGAAGGCCCTCTTCTTCGTTTCCTTTCAAATGCCCCCTGCGACCCAATTACAAACAAACCC
TACTATGACCTTGACTATGCTCTACGAATTTGCAAGCTCGCAGGATGCACAAATCCTTGTGTGCACATCTATGCG
AAAATGGGCTTGTATGAAAACAGTGTAGACTTGGCTTTGGAGAAGGGCGATTTGGAATTGGCAAAGATCAACGCG
GATAGAGTACCGGAAGAAGAGGATCAGGTCTTGAGGAAAAAGTTGTGGTTAAAGATCGCGAAGTATGTTGTACAG
GATAAGAAGGATATCAAAACGGCGATGCAATTCCTAGAGAACACAGACCTTCTAAAGATTGAAGATATACTACCG
TTCTTCCCCGACTTCGTCGTTATCGACGACTTCAAGGAAGAGATCGCGCATGCACTAGAAGAGTACTCTGCCCAT
ATTGATGAGTTGAAGAGTGAAATGGATGATGCGACGAAAACGGCAGAAAATATCAAGCAAGATATTGTGGCCCTG
AAGAATCGGTATATCACTATCAATTCGAACGCACTATGCTCCAAGTGCGAAAAGCTGCTTTTTACGAGGCAGTTC
TATGTATTCCCTTGTCATCATGTGTTCCATGCTGACTGTTTGATTGGGATGGTCAAAGAAAATTTGCCTCCCCAC
TCATTACGAAAAATTATTGCACTGCAAACAGAGCTCACAAAAGAGGCTCCGAGTACCCCATCGAAAATCCATGCC
AATGATGGAATAAGCAAACCGTCTGTGCTACCCGGAAACGTTCATCCATCGCGACAGCCAACAACGCAGCGCACC
CTTCTATCAGCCAATTTCGGTAATATCGCTGGGATGGCAGTGGCCCCGCTGAAAGGCAGTGCTCAAGCCGCAAAT
CTCCTTGGGAGAAGCGTCATTACAGCCGGGGACAAGTTGCGGGATTTGATTGTACCAGATGCATTGGCGACCATT
ATTACCTCACCAATTTGGATACCTGGTATGGGGGGCGGACAAGGGAAGAGAGGACTGGATAAAGACCTCGGGAAA
AAGGTAGAGAAATTGCGGACAGAATTGGAAGATATCTTGGCAAGTAGCTGTCCATTGTGTGAGAGTGTAATTGTG
GGTTTGGATAGACCGTTTGTAAGGGAGGGTGAGGCCGATGCTTCGTGGGTCTTGTAG
Transcript >AgabiH97|009840
ATGTTCGACGAATATGTCGAGCATGCTACGACAGGTGGTGCCTCGGCCCCAGGAGCCCTTCCGCTGCCGCAAATC
GAATATCAAGGATTCGAACCATCTCCCTACGAACCTAACGACCCTCGTACGGACATTGACGAACTTGCTCAAATA
AATGCCGCAGGCTCCAATGACCCGCCCGCACCCATCTTTGAACTCGGTCGCGTTCAATTCGCATTTCCCGCTCCC
CTCGTCTCCTTTGCCGTCAGCTCAGACTTATTGGTCATGGGTCTTAACAACAATCTCCTTGTCCTTATTGAGCTC
TCGCATGCCGATCAAGTAATCAAAATTCCAATAAATCGCAAACCTACGGAAATGACATTGCATAAACTCTTCGTG
GATCCTTCTGGGAGGCATGTAATCATCACTTCAATGCAGGGCGAGAACTGGTACCTATACCGGAATTGGAAGAAA
CCTCGAATGCTGAAAGGATTCAAAATGGTCATCGAGAGTGTCGCTTGGAATAAGGCTGCTTTATTGTCCTCCACG
CACTCGACGTCAACTAAGGAAATTCTCATCGGTGCAAGGAATGGGACGATATATGAAGCGGTTTTGGATGCCGAA
GAGGATTTGTTCAAGTCTCAAGAGCGGTATCTGCAGTCTGTGTTCTCGTTACCCGAGAGGCATCCCATCACGGGC
ATTAAATTTGATTATTTTAACCCTGTGGATGGAAGGAAAGCGCTAGTCGTTGTGACAACCACGACAAGAATATAT
CAATTTGTGGGTTCTGTGGATAAAAAGTCGGAGGTTGGCAAGGTGTTTTCGCAGTTGTTTGCTACTTACAGGGAA
GCGGCTCCAAAAATCCTCGAGCTACCGGGAGATATCCAGCATTCCGACCTTCAGTATTTCGTACCGAATGCAGAC
CAAGCTCATTCTGTTCCAAAACGAATGGCATGGATGACCGCTGCCGGGATTTATCATGGCTCCCTCAAGATTGAC
ACGGAGGCGGAAGATCATATCGATAACGCGCAACTTTTGCCATACCCCACTCTCACTGGTCTAGGGACAGGTGAT
CTGCCATTGTCGTTGGCCTTGACGGAATTCCACTTTCTTGCGCTGTACAAGGATCGAGTCGTTGGTATCTGCAAC
CTAAATGATCATGTGGCATACGAGGAACAACTGCCTGTTAAAGCGAGTGAAGCCATTCTTGGGATGGCATCAGAT
CCTGTACGTCGGACCTATTGGATCTTCACGGATCAGTCTCTTTTCGAAATTGTCGTCGGAAATGAGGATCGCGAT
GTATGGAAACTGTACCTTGAGAAAGGTCAATTTGAGACTGCCCTTCTTTTTTCAAAGACAGCATTCCAGCGTGAT
CAGGTTCTTTCTGCCCAAGCTGAAGCCTACTTCAACGAAGGGAGATATTTTCAAGCAGCTGGATGCTATGCACAA
TGCTCGGCTACGTTCGAAGAGGTTGTACTCAAGTTCCTGGATGCTGGGGAACGTGATGCCCTCCGGTCGTATCTC
ATCACACGGTTGGAGCGTACTAAGAAAACGGACCTTACCCAAAGGATGATGCTGGCAACATGGCTAGTGGAATTT
TATCTGAGCAAATGCAACGAGCTGGATGACATCGTTGCGGCAGAGTCTGTTTCGCATGATGTTGATAATTTGCAA
ACTGAGAGGGTCATACTTGAAGATGACTTGCGTCAGTTCTTCGAAACATATAGAAACAATCTGGACAAAGAGACT
GTCTATGAACTTATACAGGGTCATGGACGAACAGATATGTATCTTTATTTTGCATCAGCCGTCGGCGACCATGGT
CGCGTAGCAGAACATTGGGTATTGGAAGAGCAGTGGTCTAGAGCTATCGAAGTTATCAGCAGCCAAAACGACCTC
GAGCTCTATTACCGTTACGCCTCCGTGCTTATGCGACATGCACCGAAAGACACCGTTGACTCTTGGCTTCGTCAA
CCTTCTCTTGATCCACGACGCCTTGTTCCGGCCCTTTTACAATTGCAACATGCACCCCGCCATCCTCTCTCCCCA
AACCAAGCTATTCGCTACCTCAATTTTGTCATTTTTGAACAACTTAATACCTCGCCTACGATACATAATCTACTC
ATAACCTTTTACGTTTCCCCCTCGTCGTCGACATACATTGGCACAAGCCCTTCATCACCAAGGTCGCCTACGTCA
CAACTTCCCGAAGACGAAGGCCCTCTTCTTCGTTTCCTTTCAAATGCCCCCTGCGACCCAATTACAAACAAACCC
TACTATGACCTTGACTATGCTCTACGAATTTGCAAGCTCGCAGGATGCACAAATCCTTGTGTGCACATCTATGCG
AAAATGGGCTTGTATGAAAACAGTGTAGACTTGGCTTTGGAGAAGGGCGATTTGGAATTGGCAAAGATCAACGCG
GATAGAGTACCGGAAGAAGAGGATCAGGTCTTGAGGAAAAAGTTGTGGTTAAAGATCGCGAAGTATGTTGTACAG
GATAAGAAGGATATCAAAACGGCGATGCAATTCCTAGAGAACACAGACCTTCTAAAGATTGAAGATATACTACCG
TTCTTCCCCGACTTCGTCGTTATCGACGACTTCAAGGAAGAGATCGCGCATGCACTAGAAGAGTACTCTGCCCAT
ATTGATGAGTTGAAGAGTGAAATGGATGATGCGACGAAAACGGCAGAAAATATCAAGCAAGATATTGTGGCCCTG
AAGAATCGGTATATCACTATCAATTCGAACGCACTATGCTCCAAGTGCGAAAAGCTGCTTTTTACGAGGCAGTTC
TATGTATTCCCTTGTCATCATGTGTTCCATGCTGACTGTTTGATTGGGATGGTCAAAGAAAATTTGCCTCCCCAC
TCATTACGAAAAATTATTGCACTGCAAACAGAGCTCACAAAAGAGGCTCCGAGTACCCCATCGAAAATCCATGCC
AATGATGGAATAAGCAAACCGTCTGTGCTACCCGGAAACGTTCATCCATCGCGACAGCCAACAACGCAGCGCACC
CTTCTATCAGCCAATTTCGGTAATATCGCTGGGATGGCAGTGGCCCCGCTGAAAGGCAGTGCTCAAGCCGCAAAT
CTCCTTGGGAGAAGCGTCATTACAGCCGGGGACAAGTTGCGGGATTTGATTGTACCAGATGCATTGGCGACCATT
ATTACCTCACCAATTTGGATACCTGGTATGGGGGGCGGACAAGGGAAGAGAGGACTGGATAAAGACCTCGGGAAA
AAGGTAGAGAAATTGCGGACAGAATTGGAAGATATCTTGGCAAGTAGCTGTCCATTGTGTGAGAGTGTAATTGTG
GGTTTGGATAGACCGTTTGTAAGGGAGGGTGAGGCCGATGCTTCGTGGGTCTTGTAG
Gene >AgabiH97|009840
ATGTTCGACGAATGTAAGTCGTAGTTTTAATTGTATATCGTATAAGCATACATACTTTCACAGATGTCGAGCATG
CTACGACAGGTGGTGCCTCGGCCCCAGGAGCCCTTCCGCTGCCGCAAATCGAATATCAAGGATTCGAACCATCTC
CCTACGAACCTAACGACCCTCGTACGGACATTGACGAACTTGCTCAAGTGATTAAACCATTAGTTTTCGTATATG
TCGCTCACCACCCATTCATAGATAAATGCCGCAGGCTCCAATGACCCGCCCGCACCCATCTTTGAACTCGGTCGC
GTTCAATTCGCATTTCCCGCTCCCCTCGTCTCCTTTGCCGTCAGCTCAGACTTATTGGTCATGGGTCTTAACAAC
AATCTCCTTGTCCTTATTGAGCTCTCGCATGCCGATCAAGTAATCAAAATTCCAATAAATCGCAAACCTACGGAA
ATGACATTGCATAAACTCTTCGTGGATCCTTCTGGGAGGCATGTAATCATCACTTCAATGCAGGGCGAGAACTGG
TACCTATACCGGAATTGGAAGAAACCTCGAATGCTGAAAGGATTCAAAATGGTCATCGAGAGTGTCGCTTGGAAT
AAGGCTGCTTTATTGTCCTCCACGCACTCGACGTCAACTAAGGAAATTCTCATCGGTGCAAGGAATGGGACGATA
TATGAAGCGGTTTTGGATGCCGAAGAGGATTTGTTCAAGTCTCAAGAGCGGTATCTGCAGTCTGTGTTCTCGTTA
CCCGAGAGGCATCCCATCACGGGCATTAAATTTGATTATTTTAACCCTGTGGATGGAAGGAAAGCGCTAGTCGTT
GTGACAACCACGACAAGAATATATCAATTTGTGGGTTCTGTGGATAAAAAGTCGGAGGTTGGCAAGGTGTTTTCG
CAGTTGTTTGCTACTTACAGGGAAGCGGCTCCAAGTGCGTGCGCATCTGTTTTCCTTCTCCCTCTGGGTCTCATC
ATATAGGTCAGAAATCCTCGAGCTACCGGGAGATATCCAGCATTCCGACCTTCAGTATTTCGTACCGAATGCAGA
CCAAGCTCATTCTGTTCCAAAACGAATGGCATGGATGACCGCTGCCGGGATTTATCATGGCTCCCTCAAGATTGA
CACGGAGGCGGAAGATCATATCGATAACGCGCAACTTTTGCCATACCCCACTCTCACTGGTCTAGGGACAGGTGA
TCTGCCATTGTCGTTGGCCTTGACGGAATTCCACTTTCTTGCGCTGTACAAGGATCGAGTCGTTGGTATCTGCAA
CCTAAATGATCATGTGGCATACGAGGAACAACTGCCTGTTGTACGTTTTGGCCTAGCTAATGTGTCACCGAGTCA
CCTATTCTTGTTCCTAGAAAGCGAGTGAAGCCATTCTTGGGATGGCATCAGATCCTGTACGTCGGACCTATTGGA
TCTTCACGGATCAGTCTCTTTTCGAAATTGTCGTCGGAAATGAGGATCGCGATGTATGGAAACTGTACCTTGAGA
AAGGTCAATTTGAGACTGCCCTTCTTTTTTCAAAGGTCAATTTGAATCGTTGCCCTTGTCATGTTATAGAGTCCA
CTAATCCTGATTTGATAGACAGCATTCCAGCGTGATCAGGTTCTTTCTGCCCAAGCTGAAGCCTACTTCAACGAA
GGGAGATATTTTCAAGCAGCTGGATGCTATGCACAATGCTCGGCTACGTTCGAAGAGGTTGTACTCAAGTTCCTG
GATGCTGGGGAACGTGATGCCCTCCGGTCGTATCTCATCACACGGTTGGAGCGTACTAAGAAAACGGTATTTCGA
GAGCACTTAACCGGTTCATAGAGACTGATTCATCCCAGGACCTTACCCAAAGGATGATGCTGGCAACATGGCTAG
TGGAATTTTATCTGAGCAAATGCAACGAGCTGGATGACATCGTTGCGGCAGAGTCTGTTTCGCATGATGTTGATA
ATTTGCAAACTGAGAGGGTCATACTTGAAGATGACTTGCGTCAGTTCTTCGAAACATATAGAGTAAGTACGTGCT
CATTTTTAGTAAATGCATACGCTCAAGGCTACACAGAACAATCTGGACAAAGAGACTGTCTATGAACTTATACAG
GGTCATGGACGAACAGATATGTATCTTTATTTTGCATCAGCCGTCGGCGACCATGGTCGCGTAGCAGAACATTGG
GTATTGGAAGAGCAGTGGTCTAGAGCTATCGAAGTTATCAGCAGCCAAAACGACCTCGAGCTCTATTACCGTTAC
GCCTCCGTGCTTATGCGACATGCACCGAAAGACACCGTTGACTCTTGGCTTCGTCAACCTTCTCTTGATCCACGA
CGCCTTGTTCCGGCCCTTTTACAATTGCAACATGCACCCCGCCATCCTCTCTCCCCAAACCAAGCTATTCGCTAC
CTCAATTTTGTCATTTTTGAACAACTTAATACCTCGCCTACGATACATAATCTACTCATAACCTTTTACGTTTCC
CCCTCGTCGTCGACATACATTGGCACAAGCCCTTCATCACCAAGGTCGCCTACGTCACAACTTCCCGAAGACGAA
GGCCCTCTTCTTCGTTTCCTTTCAAATGCCCCCTGCGACCCAATTACAAACAAACCCTACTATGACCTTGACTAT
GCTCTACGAATTTGCAAGCTCGCAGGATGCACAAATCCTTGTGTGCACATCTATGCGAAAATGGGCTTGTATGAA
AACAGTGTAGACTTGGCTTTGGAGAAGGGCGATTTGGAATTGGCAAAGATCAACGCGGATAGAGTACCGGAAGAA
GAGGATCAGGTCTTGAGGAAAAAGTTGTGGTTAAAGATCGCGAAGTATGTTGTACAGGATAAGAAGGATATCAAA
ACGTAAGTGTCTGGTTGATTCCCGACTGTCGGATGTTGATATAGTCGCTGTTACAGGGCGATGCAATTCCTAGAG
AACACAGACCTTCTAAAGATTGAAGATATACTACCGTTCTTCCCCGACTTCGTCGTTATCGACGACTTCAAGGAA
GAGATCGCGCATGCACTAGAAGAGTACTCTGCCCATATTGATGAGTTGAAGAGTGAAATGGATGATGCGACGAAA
ACGGCAGAAAATATCAAGCAAGATATTGTGGCCCTGAAGAATCGGTATATCACTATCAATTCGAACGCACTATGC
TCCAAGTGCGAAAAGCTGCTTTTTACGAGGCAGTTCTATGTATTCCCTTGTCATCATGTGTTCCATGCTGACTGT
TTGATTGGGATGGTATGCCTCATCTTTTATATGGAATCAATCACGCTGATTTTACTCTCGTGCAAGGTCAAAGAA
AATTTGCCTCCCCACTCATTACGAAAAATTATTGCACTGCAAACAGAGCTCACAAAAGAGGCTCCGAGTACCCCA
TCGAAAATCCATGCCAATGATGGAATAAGCAAACCGTCTGTGCTACCCGGAAACGTTCATCCATCGCGACAGCCA
ACAACGCAGCGCACCCTTCTATCAGCCAATTTCGGTAATATCGCTGGGATGGCAGTGGCCCCGCTGAAAGGCAGT
GCTCAAGCCGCAAATCTCCTTGGGAGAAGCGTCATTACAGCCGGGGACAAGTTGCGGGATTTGATTGTACCAGAT
GCATTGGCGACCATTATTACCTCACCAATTTGGATACCTGGTATGGGGGGCGGACAAGGGAAGAGAGGACTGGAT
AAAGACCTCGGGAAAAAGGTAGAGAAATTGCGGACAGAATTGGAAGATATCTTGGCAAGTAGCTGTCCATTGTGT
GAGAGTGTAATTGTGGGTTTGGATAGACCGTTTGTAAGGGAGGGTGAGGCCGATGCTTCGTGGGTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail