Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009810
Gene name
Locationscaffold_1:2314761..2318039
Strand+
Gene length (bp)3278
Transcript length (bp)3171
Coding sequence length (bp)3171
Protein length (aa) 1057

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08314 Sec39 Secretory pathway protein Sec39 7.1E-96 195 900

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5TYW4|NBAS_DANRE Neuroblastoma-amplified sequence OS=Danio rerio GN=nbas PE=2 SV=1 184 894 2.0E-37
sp|A2RRP1|NBAS_HUMAN Neuroblastoma-amplified sequence OS=Homo sapiens GN=NBAS PE=1 SV=2 184 919 1.0E-35
sp|Q9FIN7|MIP2_ARATH MAG2-interacting protein 2 OS=Arabidopsis thaliana GN=MIP2 PE=1 SV=1 186 889 4.0E-32
sp|O14266|SEC39_SCHPO Protein transport protein sec39 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec39 PE=3 SV=1 633 778 5.0E-06

GO

GO Term Description Terminal node
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0048193 Golgi vesicle transport No
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009810
MTSSTSNPSEQWVSISDTDLTVDNVQNILGNVKDDLWVVAACVDRLCDSIPVQQALLQTGLSRTCSAIQRCKDAL
AMAPGTSSDEPREVSRSPIIAHFRSVPGDAQLCHFRSILLGRQDLLNTYTEIDSKAPLVEGEDEGEGTEAEANVE
EGSEDWDDPWAEDSTNKPTPTTVQKKPLPVPFSLSQFMTNELLWSACRLASLEWFDALRVLLDRHGSYLWSLRMA
ILENIPEYAHPSEFQSLILKYDFTSNQELKPSPVPWRPEEDFVESKVAQQAMQESGTEISTGMRPVADALETTSH
PEPLTGHELATWFKNRVDVIISSTGMIDIALALVQYGASQGIPGLDEVGEELSLLSRLTYDTPFADEKSDDWTLA
RWQSMDPPAVVRAYLVNSTPDSVPRDILRLVLPYLFVLEARAERAGKPDPEIHTRLLCDYVLTSPLEIVASIFDA
SKPTLPIPQRIIRDDEDLARLALACLYGSNSLNEWSTMSRIFECLPAWDYSQDEDDDGDVADTTIASLGAFVAPT
TTRPHVSPTELMTFFKPLHITSLSRALDILDVHLEAGEIFSRWNVPAPLKWFLRGNDDAKEQQAWSNRMARRAGG
MHDQLNKVVDWEWLLEDMMKLTGKSEAGIRNAFGLLSEEEVMRVFLAGLLSTGKFDIARSMLYGSRSKIRLEPEV
IEEIVVTSSHELYDNASSGNCKVGDMKLAYDCLDVPPLSERLTREKEFIEATSRIASFNVLSRPGIPISPIEIRL
TKDRLSLVSRVLSSNNDAYKHTEVILDLCYKLGFQGDAVAEVKALAMLAATALQAEDFVRAYENTLRMIDIVKQH
HEAPTSSDTQKGKVEEMTEVCWIGCFQLGRQPEFADLKKKLQLIGSALELCPSEKLHDVLTVWKRLEKEDIVIRE
EDLVQKKQLHVGGKSLTSSLHRHQQKHGITNGNGRAWGHAPVVTSQSLNTAASSLRAKLQQFHMPSPPLLSTPDA
AALASRTFRSVTANFPFSVGPRSTTPSQASHREYESHQHRYDAGKGSQVSDSGHHRLDDVQAQATKVFSKGIGWL
IGADDE*
Coding >AgabiH97|009810
ATGACTTCAAGCACTTCAAACCCCTCCGAGCAATGGGTCTCAATCTCTGACACTGACCTCACTGTCGACAACGTT
CAGAACATCCTGGGGAATGTCAAGGATGACCTCTGGGTGGTCGCAGCTTGCGTTGACCGCCTGTGTGATAGCATT
CCCGTTCAACAAGCACTCCTGCAAACTGGCTTGTCAAGAACCTGCTCGGCCATCCAGAGGTGCAAAGATGCTTTA
GCTATGGCTCCAGGAACCTCTTCGGATGAACCTCGCGAGGTTTCTCGTAGCCCTATCATTGCTCACTTTCGTTCC
GTTCCTGGTGACGCTCAACTATGCCATTTCCGCTCAATCCTCCTCGGTCGACAGGATCTCCTCAACACATATACG
GAAATAGATAGTAAAGCGCCTTTAGTGGAAGGGGAAGATGAGGGAGAAGGCACCGAGGCCGAAGCAAATGTTGAA
GAGGGATCAGAGGATTGGGATGACCCATGGGCAGAGGACTCCACCAACAAACCTACCCCGACAACCGTACAAAAG
AAACCCTTACCTGTGCCGTTTTCCCTTTCACAGTTCATGACCAATGAACTTCTATGGTCTGCTTGTCGTCTCGCA
TCCTTGGAGTGGTTTGACGCATTGCGTGTGCTGCTGGACAGACATGGATCATACTTATGGTCATTACGAATGGCA
ATTTTGGAGAATATCCCTGAATATGCGCATCCCTCTGAGTTTCAGTCGCTCATTTTGAAATACGACTTCACTTCT
AACCAAGAGTTGAAGCCCTCTCCAGTGCCCTGGAGGCCGGAGGAGGATTTTGTAGAATCTAAGGTTGCTCAACAG
GCTATGCAAGAGAGTGGTACGGAAATCTCAACCGGTATGCGACCCGTAGCAGACGCTCTGGAAACAACTTCTCAT
CCAGAACCTCTAACTGGTCACGAGCTTGCGACGTGGTTCAAAAATCGCGTCGACGTGATAATTAGTTCCACTGGA
ATGATCGATATTGCACTGGCCTTGGTCCAATATGGTGCTTCACAAGGTATTCCCGGTCTCGATGAAGTCGGCGAG
GAACTCAGCCTGCTTTCACGGCTCACGTACGATACACCTTTTGCCGATGAAAAATCAGACGATTGGACACTTGCT
CGCTGGCAGTCCATGGATCCTCCCGCTGTTGTACGCGCATACTTGGTCAACTCAACGCCGGACTCTGTACCTCGA
GACATTCTTCGCCTCGTCCTTCCTTATCTTTTCGTTTTGGAAGCTCGTGCAGAACGTGCCGGTAAACCGGATCCC
GAGATTCATACCCGTCTTTTATGTGATTACGTCCTCACCTCGCCTTTGGAAATCGTGGCGTCTATTTTCGACGCA
TCCAAACCCACGCTGCCCATACCACAGCGAATCATCAGGGACGACGAGGACCTGGCGCGTTTAGCTTTGGCATGC
CTGTACGGAAGTAATAGTCTCAACGAATGGTCGACTATGAGTCGTATATTCGAGTGTTTGCCAGCTTGGGACTAT
TCTCAAGATGAAGACGATGACGGGGATGTGGCCGATACGACGATTGCGTCTCTCGGTGCCTTCGTTGCGCCTACG
ACTACGCGTCCTCACGTTTCCCCGACAGAACTCATGACTTTCTTCAAGCCTCTGCACATTACTTCATTATCTCGT
GCTCTCGATATACTGGATGTACACCTTGAAGCTGGAGAGATTTTTTCACGTTGGAATGTTCCTGCTCCATTGAAA
TGGTTTTTACGGGGCAATGACGACGCGAAAGAGCAGCAAGCGTGGTCGAATAGGATGGCCAGACGTGCGGGCGGA
ATGCATGACCAGTTAAATAAAGTGGTCGATTGGGAATGGTTATTGGAGGACATGATGAAGTTGACGGGAAAGAGC
GAGGCAGGCATTAGGAATGCCTTCGGACTCTTGAGTGAAGAGGAGGTAATGAGAGTCTTCTTGGCTGGGCTATTG
AGCACTGGTAAATTTGATATTGCTCGTTCAATGCTATATGGTTCACGCAGCAAGATACGTTTGGAACCTGAAGTT
ATAGAGGAAATCGTCGTTACATCATCACATGAGCTATACGACAACGCCAGCTCCGGCAATTGCAAAGTCGGTGAC
ATGAAGTTGGCATACGATTGTTTGGATGTCCCCCCGTTGTCTGAACGGCTTACTCGTGAGAAGGAATTCATCGAA
GCAACGTCTCGTATCGCGTCCTTTAATGTCCTATCCCGCCCGGGTATCCCTATATCTCCCATTGAGATTCGTCTC
ACGAAAGACCGCCTATCTCTCGTCTCTCGTGTGCTTTCCAGCAATAACGACGCATACAAGCACACGGAAGTCATA
CTGGACCTATGTTACAAGCTTGGATTCCAGGGTGATGCAGTAGCTGAAGTCAAGGCTCTGGCCATGCTTGCTGCT
ACCGCTCTCCAAGCTGAGGACTTCGTCCGGGCCTATGAGAATACACTTCGGATGATTGATATCGTCAAACAGCAT
CATGAGGCTCCTACCTCTTCAGATACCCAGAAAGGCAAGGTGGAAGAGATGACGGAAGTGTGTTGGATTGGATGT
TTCCAGCTAGGCCGACAGCCTGAATTTGCTGATCTCAAGAAAAAATTGCAACTCATTGGTTCTGCTCTCGAGCTT
TGTCCATCTGAAAAGCTTCACGACGTTCTTACGGTGTGGAAACGCCTTGAAAAAGAGGACATTGTAATTCGTGAA
GAAGACCTTGTTCAAAAGAAACAACTCCACGTGGGTGGTAAATCATTGACAAGTTCTTTACATCGACACCAGCAA
AAGCATGGTATCACGAATGGAAACGGGCGTGCGTGGGGACATGCCCCTGTCGTGACAAGCCAATCGTTAAACACT
GCCGCCTCCTCGCTCCGTGCTAAACTCCAACAATTCCATATGCCCTCACCTCCGCTACTGTCAACACCTGATGCA
GCCGCGTTGGCCAGTCGCACATTTCGTAGCGTCACTGCCAACTTCCCTTTTTCAGTCGGCCCGCGTAGTACCACT
CCTTCGCAAGCATCTCATCGCGAGTACGAAAGCCACCAGCATCGGTATGACGCTGGCAAGGGATCGCAAGTCTCA
GACTCGGGTCATCATCGTTTGGATGATGTACAAGCGCAAGCCACAAAAGTATTTTCCAAGGGTATTGGATGGCTT
ATCGGTGCAGACGATGAGTAG
Transcript >AgabiH97|009810
ATGACTTCAAGCACTTCAAACCCCTCCGAGCAATGGGTCTCAATCTCTGACACTGACCTCACTGTCGACAACGTT
CAGAACATCCTGGGGAATGTCAAGGATGACCTCTGGGTGGTCGCAGCTTGCGTTGACCGCCTGTGTGATAGCATT
CCCGTTCAACAAGCACTCCTGCAAACTGGCTTGTCAAGAACCTGCTCGGCCATCCAGAGGTGCAAAGATGCTTTA
GCTATGGCTCCAGGAACCTCTTCGGATGAACCTCGCGAGGTTTCTCGTAGCCCTATCATTGCTCACTTTCGTTCC
GTTCCTGGTGACGCTCAACTATGCCATTTCCGCTCAATCCTCCTCGGTCGACAGGATCTCCTCAACACATATACG
GAAATAGATAGTAAAGCGCCTTTAGTGGAAGGGGAAGATGAGGGAGAAGGCACCGAGGCCGAAGCAAATGTTGAA
GAGGGATCAGAGGATTGGGATGACCCATGGGCAGAGGACTCCACCAACAAACCTACCCCGACAACCGTACAAAAG
AAACCCTTACCTGTGCCGTTTTCCCTTTCACAGTTCATGACCAATGAACTTCTATGGTCTGCTTGTCGTCTCGCA
TCCTTGGAGTGGTTTGACGCATTGCGTGTGCTGCTGGACAGACATGGATCATACTTATGGTCATTACGAATGGCA
ATTTTGGAGAATATCCCTGAATATGCGCATCCCTCTGAGTTTCAGTCGCTCATTTTGAAATACGACTTCACTTCT
AACCAAGAGTTGAAGCCCTCTCCAGTGCCCTGGAGGCCGGAGGAGGATTTTGTAGAATCTAAGGTTGCTCAACAG
GCTATGCAAGAGAGTGGTACGGAAATCTCAACCGGTATGCGACCCGTAGCAGACGCTCTGGAAACAACTTCTCAT
CCAGAACCTCTAACTGGTCACGAGCTTGCGACGTGGTTCAAAAATCGCGTCGACGTGATAATTAGTTCCACTGGA
ATGATCGATATTGCACTGGCCTTGGTCCAATATGGTGCTTCACAAGGTATTCCCGGTCTCGATGAAGTCGGCGAG
GAACTCAGCCTGCTTTCACGGCTCACGTACGATACACCTTTTGCCGATGAAAAATCAGACGATTGGACACTTGCT
CGCTGGCAGTCCATGGATCCTCCCGCTGTTGTACGCGCATACTTGGTCAACTCAACGCCGGACTCTGTACCTCGA
GACATTCTTCGCCTCGTCCTTCCTTATCTTTTCGTTTTGGAAGCTCGTGCAGAACGTGCCGGTAAACCGGATCCC
GAGATTCATACCCGTCTTTTATGTGATTACGTCCTCACCTCGCCTTTGGAAATCGTGGCGTCTATTTTCGACGCA
TCCAAACCCACGCTGCCCATACCACAGCGAATCATCAGGGACGACGAGGACCTGGCGCGTTTAGCTTTGGCATGC
CTGTACGGAAGTAATAGTCTCAACGAATGGTCGACTATGAGTCGTATATTCGAGTGTTTGCCAGCTTGGGACTAT
TCTCAAGATGAAGACGATGACGGGGATGTGGCCGATACGACGATTGCGTCTCTCGGTGCCTTCGTTGCGCCTACG
ACTACGCGTCCTCACGTTTCCCCGACAGAACTCATGACTTTCTTCAAGCCTCTGCACATTACTTCATTATCTCGT
GCTCTCGATATACTGGATGTACACCTTGAAGCTGGAGAGATTTTTTCACGTTGGAATGTTCCTGCTCCATTGAAA
TGGTTTTTACGGGGCAATGACGACGCGAAAGAGCAGCAAGCGTGGTCGAATAGGATGGCCAGACGTGCGGGCGGA
ATGCATGACCAGTTAAATAAAGTGGTCGATTGGGAATGGTTATTGGAGGACATGATGAAGTTGACGGGAAAGAGC
GAGGCAGGCATTAGGAATGCCTTCGGACTCTTGAGTGAAGAGGAGGTAATGAGAGTCTTCTTGGCTGGGCTATTG
AGCACTGGTAAATTTGATATTGCTCGTTCAATGCTATATGGTTCACGCAGCAAGATACGTTTGGAACCTGAAGTT
ATAGAGGAAATCGTCGTTACATCATCACATGAGCTATACGACAACGCCAGCTCCGGCAATTGCAAAGTCGGTGAC
ATGAAGTTGGCATACGATTGTTTGGATGTCCCCCCGTTGTCTGAACGGCTTACTCGTGAGAAGGAATTCATCGAA
GCAACGTCTCGTATCGCGTCCTTTAATGTCCTATCCCGCCCGGGTATCCCTATATCTCCCATTGAGATTCGTCTC
ACGAAAGACCGCCTATCTCTCGTCTCTCGTGTGCTTTCCAGCAATAACGACGCATACAAGCACACGGAAGTCATA
CTGGACCTATGTTACAAGCTTGGATTCCAGGGTGATGCAGTAGCTGAAGTCAAGGCTCTGGCCATGCTTGCTGCT
ACCGCTCTCCAAGCTGAGGACTTCGTCCGGGCCTATGAGAATACACTTCGGATGATTGATATCGTCAAACAGCAT
CATGAGGCTCCTACCTCTTCAGATACCCAGAAAGGCAAGGTGGAAGAGATGACGGAAGTGTGTTGGATTGGATGT
TTCCAGCTAGGCCGACAGCCTGAATTTGCTGATCTCAAGAAAAAATTGCAACTCATTGGTTCTGCTCTCGAGCTT
TGTCCATCTGAAAAGCTTCACGACGTTCTTACGGTGTGGAAACGCCTTGAAAAAGAGGACATTGTAATTCGTGAA
GAAGACCTTGTTCAAAAGAAACAACTCCACGTGGGTGGTAAATCATTGACAAGTTCTTTACATCGACACCAGCAA
AAGCATGGTATCACGAATGGAAACGGGCGTGCGTGGGGACATGCCCCTGTCGTGACAAGCCAATCGTTAAACACT
GCCGCCTCCTCGCTCCGTGCTAAACTCCAACAATTCCATATGCCCTCACCTCCGCTACTGTCAACACCTGATGCA
GCCGCGTTGGCCAGTCGCACATTTCGTAGCGTCACTGCCAACTTCCCTTTTTCAGTCGGCCCGCGTAGTACCACT
CCTTCGCAAGCATCTCATCGCGAGTACGAAAGCCACCAGCATCGGTATGACGCTGGCAAGGGATCGCAAGTCTCA
GACTCGGGTCATCATCGTTTGGATGATGTACAAGCGCAAGCCACAAAAGTATTTTCCAAGGGTATTGGATGGCTT
ATCGGTGCAGACGATGAGTAG
Gene >AgabiH97|009810
ATGACTTCAAGCACTTCAAACCCCTCCGAGCAATGGGTCTCAATCTCTGACACTGACCTCACTGTCGACAACGTT
CAGAACATCCTGGGGAATGTCAAGGATGACCTCTGGGTGGTCGCAGCTTGCGTTGACCGCCTGTGTGATAGCATT
CCCGTTCAACAAGCACTCCTGCAAACTGGCTTGTCAAGAACCTGCTCGGCCATCCAGAGGTGCAAAGATGCTTTA
GCTATGGCTCCAGGAACCTCTTCGGATGAACCTCGCGAGGTTTCTCGTAGCCCTATCATTGCTCACTTTCGTTCC
GTTCCTGGTGACGCTCAACTATGCCATTTCCGCTCAATCCTCCTCGGTCGACAGGATCTCCTCAACACATATACG
GAAATAGATAGTAAAGCGCCTTTAGTGGAAGGGGAAGATGAGGGAGAAGGCACCGAGGCCGAAGCAAATGTTGAA
GAGGGATCAGAGGATTGGGATGACCCATGGGCAGAGGACTCCACCAACAAACCTACCCCGACAACCGTACAAAAG
AAACCCTTACCTGTGCCGTTTTCCCTTTCACAGTTCATGACCAATGAACTTCTATGGTCTGCTTGTCGTCTCGCA
TCCTTGGAGTGGTTTGACGCATTGCGTGTGCTGCTGGACAGACATGGATCATACTTATGGTCATTACGAATGGCA
ATTTTGGAGAATATCCCTGAATATGCGCATCCCTCTGAGTTTCAGTCGCTCATTTTGAAATACGACTTCACTTCT
AACCAAGAGTTGAAGCCCTCTCCAGTGCCCTGGAGGCCGGAGGAGGATTTTGTAGAATCTAAGGTTGCTCAACAG
GCTATGCAAGAGAGTGGTACGGAAATCTCAACCGGTATGCGACCCGTAGCAGACGCTCTGGAAACAACTTCTCAT
CCAGAACCTCTAACTGGTCACGAGCTTGCGACGTGGTTCAAAAATCGCGTCGACGTGATAATTAGTTCCACTGGA
ATGATCGATATTGCACTGGCCTTGGTCCAATATGGTGCTTCACAAGGTATTCCCGGTCTCGATGAAGTCGGCGAG
GAACTCAGCCTGCTTTCACGGCTCACGTACGATACACCTTTTGCCGATGAAAAATCAGACGATTGGACACTTGCT
CGCTGGCAGTCCATGGATCCTCCCGCTGTTGTACGCGCATACTTGGTCAACTCAACGCCGGACTCTGTACCTCGA
GACATTCTTCGCCTCGTCCTTCCTTATCTTTTCGTTTTGGAAGCTCGTGCAGAACGTGCCGGTAAACCGGATCCC
GAGATTCATACCCGTCTTTTATGTGATTACGTCCTCACCTCGCCTTTGGAAATCGTGGCGTCTATTTTCGACGCA
TCCAAACCCACGCTGCCCATACCACAGCGAATCATCAGGGACGACGAGGACCTGGCGCGTTTAGCTTTGGCATGC
CTGTACGGAAGTAATAGTCTCAACGAATGGTCGACTATGAGTCGTATATTCGAGTGTTTGCCAGCTTGGGACTAT
TCTCAAGATGAAGACGATGACGGGGATGTGGCCGATACGACGATTGCGTCTCTCGGTGCCTTCGTTGCGCCTACG
ACTACGCGTCCTCACGTTTCCCCGACAGAACTCATGACTTTCTTCAAGCCTCTGCACATTACTTCATTATCTCGT
GCTCTCGATATACTGGATGTACACCTTGAAGCTGGAGAGATTTTTTCACGTTGGAATGTTCCTGCTCCATTGAAA
TGGTTTTTACGGGGCAATGACGACGCGAAAGAGCAGCAAGCGTGGTCGAATAGGATGGCCAGACGTGCGGGCGGA
ATGCATGACCAGTTAAATAAAGTGGTCGATTGGGAATGGTTATTGGAGGACATGATGAAGTTGACGGGAAAGAGC
GAGGCAGGCATTAGGAATGCCTTCGGACTCTTGAGTGAAGAGGAGGTAATGAGAGTCTTCTTGGCTGGGCTATTG
AGCACTGGTAGTACGTCGTCACCGTTTAATGCTCGTATAGTGTTTCTGAGAATATATCTCACAGAATTTGATATT
GCTCGTTCAATGCTATATGGTTCACGCAGCAAGATACGTTTGGAACCTGAAGTTATAGAGGAAATCGTCGTTACA
TCATCACATGAGCTATACGACAACGCCAGCTCCGGCAATTGCAAAGTCGGTGACATGAAGTTGGCATACGATTGG
TATGTCCATCTCTGCTTTTCCCGCTCCCTGTCGTGGCTAAATTTCGCATAAGTTTGGATGTCCCCCCGTTGTCTG
AACGGCTTACTCGTGAGAAGGAATTCATCGAAGCAACGTCTCGTATCGCGTCCTTTAATGTCCTATCCCGCCCGG
GTATCCCTATATCTCCCATTGAGATTCGTCTCACGAAAGACCGCCTATCTCTCGTCTCTCGTGTGCTTTCCAGCA
ATAACGACGCATACAAGCACACGGAAGTCATACTGGACCTATGTTACAAGCTTGGATTCCAGGGTGATGCAGTAG
CTGAAGTCAAGGCTCTGGCCATGCTTGCTGCTACCGCTCTCCAAGCTGAGGACTTCGTCCGGGCCTATGAGAATA
CACTTCGGATGATTGATATCGTCAAACAGCATCATGAGGCTCCTACCTCTTCAGATACCCAGAAAGGCAAGGTGG
AAGAGATGACGGAAGTGTGTTGGATTGGATGTTTCCAGCTAGGCCGACAGCCTGAATTTGCTGATCTCAAGAAAA
AATTGCAACTCATTGGTTCTGCTCTCGAGCTTTGTCCATCTGAAAAGCTTCACGACGTTCTTACGGTGTGGAAAC
GCCTTGAAAAAGAGGACATTGTAATTCGTGAAGAAGACCTTGTTCAAAAGAAACAACTCCACGTGGGTGGTAAAT
CATTGACAAGTTCTTTACATCGACACCAGCAAAAGCATGGTATCACGAATGGAAACGGGCGTGCGTGGGGACATG
CCCCTGTCGTGACAAGCCAATCGTTAAACACTGCCGCCTCCTCGCTCCGTGCTAAACTCCAACAATTCCATATGC
CCTCACCTCCGCTACTGTCAACACCTGATGCAGCCGCGTTGGCCAGTCGCACATTTCGTAGCGTCACTGCCAACT
TCCCTTTTTCAGTCGGCCCGCGTAGTACCACTCCTTCGCAAGCATCTCATCGCGAGTACGAAAGCCACCAGCATC
GGTATGACGCTGGCAAGGGATCGCAAGTCTCAGACTCGGGTCATCATCGTTTGGATGATGTACAAGCGCAAGCCA
CAAAAGTATTTTCCAAGGGTATTGGATGGCTTATCGGTGCAGACGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail