Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009740
Gene name
Locationscaffold_1:2297015..2298328
Strand-
Gene length (bp)1313
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.9E-21 29 310
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.4E-16 31 316
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-10 26 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 27 324 2.0E-30
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 29 324 2.0E-29
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 29 324 2.0E-29
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 29 324 8.0E-28
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 10 152 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 27 324 2.0E-30
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 29 324 2.0E-29
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 29 324 2.0E-29
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 29 324 8.0E-28
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 10 152 1.0E-18
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 10 166 2.0E-18
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 9 120 1.0E-15
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 14 120 2.0E-15
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 10 325 3.0E-12
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 10 120 2.0E-11
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 9 115 2.0E-10
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 19 120 2.0E-10
sp|Q98C03|DHAA_RHILO Haloalkane dehalogenase OS=Rhizobium loti (strain MAFF303099) GN=dhaA PE=3 SV=1 27 128 2.0E-10
sp|B4RF90|DHMA_PHEZH Haloalkane dehalogenase OS=Phenylobacterium zucineum (strain HLK1) GN=dhmA PE=3 SV=1 24 124 4.0E-10
sp|Q73Y99|DHMA_MYCPA Haloalkane dehalogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dhmA PE=3 SV=1 19 134 1.0E-09
sp|Q93K00|DHMA_MYCAV Haloalkane dehalogenase OS=Mycobacterium avium GN=dhmA PE=1 SV=1 19 134 1.0E-09
sp|Q1JU72|DEHA_BURSP Fluoroacetate dehalogenase OS=Burkholderia sp. GN=fac-dex PE=1 SV=1 27 130 2.0E-09
sp|Q1QBB9|DHMA_PSYCK Haloalkane dehalogenase OS=Psychrobacter cryohalolentis (strain K5) GN=dhmA PE=3 SV=1 19 122 2.0E-09
sp|B0SY51|DHMA_CAUSK Haloalkane dehalogenase OS=Caulobacter sp. (strain K31) GN=dhmA PE=3 SV=1 19 125 3.0E-09
sp|Q9A919|DHMA_CAUCR Haloalkane dehalogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dhmA PE=3 SV=1 24 122 4.0E-09
sp|B8H3S9|DHMA_CAUCN Haloalkane dehalogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=dhmA PE=3 SV=1 24 122 4.0E-09
sp|B2HJU9|DHMA_MYCMM Haloalkane dehalogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dhmA PE=3 SV=1 19 134 3.0E-08
sp|P64302|DHMA1_MYCBO Haloalkane dehalogenase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dhmA1 PE=3 SV=1 19 134 4.0E-08
sp|P9WMS2|DHMA1_MYCTO Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dhmA1 PE=3 SV=1 19 134 4.0E-08
sp|P9WMS3|DHMA1_MYCTU Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dhmA1 PE=1 SV=1 19 134 4.0E-08
sp|P59337|DHAA_BRADU Haloalkane dehalogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dhaA PE=1 SV=1 24 138 7.0E-08
sp|P53750|YN93_YEAST Uncharacterized hydrolase YNR064C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR064C PE=3 SV=1 19 124 1.0E-07
sp|Q6NAM1|DEHA_RHOPA Fluoroacetate dehalogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA1163 PE=1 SV=1 29 166 2.0E-07
sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 9 123 3.0E-07
sp|P9WNH3|Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2715 PE=1 SV=1 9 123 3.0E-07
sp|P9WNH2|Y2715_MYCTO Uncharacterized protein MT2788 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2788 PE=3 SV=1 9 123 3.0E-07
sp|P59336|DHAA_RHOSD Haloalkane dehalogenase OS=Rhodococcus sp. (strain TDTM0003) GN=dhaA PE=1 SV=1 9 326 7.0E-07
sp|P29715|BPOA2_STRAU Non-haem bromoperoxidase BPO-A2 OS=Streptomyces aureofaciens GN=bpoA2 PE=1 SV=3 27 129 2.0E-06
sp|O31168|PRXC_STRAU Non-heme chloroperoxidase OS=Streptomyces aureofaciens GN=cpo PE=1 SV=1 31 129 2.0E-06
sp|P0A3G4|DHAA_PSEPV Haloalkane dehalogenase OS=Pseudomonas pavonaceae GN=dhaA PE=1 SV=1 9 325 2.0E-06
sp|P0A3G2|DHAA_RHORH Haloalkane dehalogenase OS=Rhodococcus rhodochrous GN=dhaA PE=1 SV=1 9 325 2.0E-06
sp|P0A3G3|DHAA_RHOSO Haloalkane dehalogenase OS=Rhodococcus sp. GN=dhaA PE=1 SV=1 9 325 2.0E-06
sp|Q9ZER0|DHAA_MYCSX Haloalkane dehalogenase OS=Mycobacterium sp. (strain GP1) GN=dhaAF PE=2 SV=1 9 156 3.0E-06
sp|O52866|HYES_CORS2 Soluble epoxide hydrolase OS=Corynebacterium sp. (strain C12) PE=1 SV=3 14 115 3.0E-06
sp|Q8R0P8|ABHD8_MOUSE Abhydrolase domain-containing protein 8 OS=Mus musculus GN=Abhd8 PE=2 SV=1 24 120 5.0E-06
sp|Q4R584|ABHD8_MACFA Abhydrolase domain-containing protein 8 OS=Macaca fascicularis GN=ABHD8 PE=2 SV=1 24 120 5.0E-06
sp|Q96I13|ABHD8_HUMAN Abhydrolase domain-containing protein 8 OS=Homo sapiens GN=ABHD8 PE=2 SV=1 24 120 6.0E-06
sp|Q17QP1|ABHD8_BOVIN Abhydrolase domain-containing protein 8 OS=Bos taurus GN=ABHD8 PE=2 SV=1 24 120 6.0E-06
sp|Q6Q3H0|DHLA_XANFL Haloalkane dehalogenase OS=Xanthobacter flavus GN=dhlA PE=3 SV=1 14 122 7.0E-06
sp|P22643|DHLA_XANAU Haloalkane dehalogenase OS=Xanthobacter autotrophicus GN=dhlA PE=1 SV=2 14 122 7.0E-06
sp|C5CN82|RUTD_VARPS Putative aminoacrylate hydrolase RutD OS=Variovorax paradoxus (strain S110) GN=rutD PE=3 SV=1 19 121 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009740
MDSSSYKDFITSRGYNYHYYFAPGQETKPTLLLLHGFPSLANDWHNQVTSLRAHGYGFIVPDMLGYGGTAKPTDA
NDYKQSLMVKDLIDILDAEKITRCVVIGHDWGSIVTARLANYYPDRFLGFGFLAVGYLPPNPTHTYEDTLELMRK
SFGSERLGYQSFFAEPDGHILCEKNFDTFYSIVHPKDYGTIWPQALYSLGETRKWIERNVPVEIEPSIPEEEHAY
KKEQLKKSGLRAAMSWYTVSVKNLELEEIKQIPQSAYTIEKPVFLGLTEKDPLCPPAISKPSAEQFCKNVTIKVF
DCGHWIFWEKRDELNKELAAWLETLGH*
Coding >AgabiH97|009740
ATGGATTCAAGCAGCTATAAGGATTTCATCACCTCTCGCGGTTACAACTATCACTACTACTTCGCACCTGGACAG
GAGACAAAACCCACCCTCCTCCTCCTTCATGGCTTTCCAAGCTTAGCAAATGACTGGCATAACCAAGTAACGAGC
CTCCGAGCTCACGGTTACGGGTTCATTGTTCCAGATATGCTTGGATATGGTGGTACTGCTAAACCAACGGACGCA
AATGACTACAAGCAGAGTCTCATGGTCAAAGACTTGATCGACATCCTTGATGCGGAAAAGATAACCCGTTGCGTC
GTCATCGGTCATGACTGGGGTTCCATAGTTACTGCTCGCCTTGCCAATTATTATCCCGATCGCTTCTTGGGATTC
GGTTTCCTGGCTGTTGGTTATTTACCCCCAAATCCCACTCACACTTATGAAGACACCCTGGAGCTGATGAGAAAG
TCATTTGGATCAGAGAGACTTGGTTATCAATCTTTTTTTGCTGAACCGGACGGCCATATTTTATGTGAAAAGAAC
TTTGACACCTTTTACAGCATCGTTCACCCCAAGGATTACGGCACCATATGGCCTCAGGCCCTATACAGTTTAGGC
GAGACCAGAAAGTGGATTGAACGCAATGTGCCAGTTGAGATAGAGCCTTCAATTCCAGAAGAAGAACATGCGTAT
AAGAAGGAGCAGCTCAAGAAAAGCGGTCTCAGAGCAGCCATGAGTTGGTACACAGTTTCGGTCAAAAATCTCGAA
TTGGAAGAAATTAAACAAATTCCACAGTCGGCCTACACAATTGAAAAACCCGTTTTTCTCGGTCTCACAGAGAAA
GATCCTCTTTGCCCTCCAGCCATCTCAAAGCCATCAGCAGAGCAGTTCTGCAAGAATGTTACTATAAAAGTCTTC
GATTGTGGTCATTGGATCTTCTGGGAGAAGAGAGACGAGCTCAATAAAGAGCTCGCTGCTTGGCTAGAGACTTTG
GGACACTGA
Transcript >AgabiH97|009740
ATGGATTCAAGCAGCTATAAGGATTTCATCACCTCTCGCGGTTACAACTATCACTACTACTTCGCACCTGGACAG
GAGACAAAACCCACCCTCCTCCTCCTTCATGGCTTTCCAAGCTTAGCAAATGACTGGCATAACCAAGTAACGAGC
CTCCGAGCTCACGGTTACGGGTTCATTGTTCCAGATATGCTTGGATATGGTGGTACTGCTAAACCAACGGACGCA
AATGACTACAAGCAGAGTCTCATGGTCAAAGACTTGATCGACATCCTTGATGCGGAAAAGATAACCCGTTGCGTC
GTCATCGGTCATGACTGGGGTTCCATAGTTACTGCTCGCCTTGCCAATTATTATCCCGATCGCTTCTTGGGATTC
GGTTTCCTGGCTGTTGGTTATTTACCCCCAAATCCCACTCACACTTATGAAGACACCCTGGAGCTGATGAGAAAG
TCATTTGGATCAGAGAGACTTGGTTATCAATCTTTTTTTGCTGAACCGGACGGCCATATTTTATGTGAAAAGAAC
TTTGACACCTTTTACAGCATCGTTCACCCCAAGGATTACGGCACCATATGGCCTCAGGCCCTATACAGTTTAGGC
GAGACCAGAAAGTGGATTGAACGCAATGTGCCAGTTGAGATAGAGCCTTCAATTCCAGAAGAAGAACATGCGTAT
AAGAAGGAGCAGCTCAAGAAAAGCGGTCTCAGAGCAGCCATGAGTTGGTACACAGTTTCGGTCAAAAATCTCGAA
TTGGAAGAAATTAAACAAATTCCACAGTCGGCCTACACAATTGAAAAACCCGTTTTTCTCGGTCTCACAGAGAAA
GATCCTCTTTGCCCTCCAGCCATCTCAAAGCCATCAGCAGAGCAGTTCTGCAAGAATGTTACTATAAAAGTCTTC
GATTGTGGTCATTGGATCTTCTGGGAGAAGAGAGACGAGCTCAATAAAGAGCTCGCTGCTTGGCTAGAGACTTTG
GGACACTGA
Gene >AgabiH97|009740
ATGGATTCAAGCAGCTATAAGGATTTCATCACCTCTCGCGGTTACAACTATCACTACTACTTCGCACCTGGACAG
GAGACAAAACCCACCCTCCTCCTCCTTCATGGCTTTCCAAGCTTAGCAAATGACTGGCATAACCAAGTAACGAGC
CTCCGAGCTCACGGTTACGGGTTCATTGTTCCAGATATGCTTGGATATGGTGGTACTGCTAAACCAACGGACGCA
AATGACTACAAGCAGAGTCTCATGGTCAAAGACTTGATCGACATCCTTGATGCGGAAAAGATAACCCGTTGCGTC
GTCATCGGTCATGACTGGTGACTATCGTCATTACGATGTAGCGCTGGCGATGCTCAATCAGATACAGGGGTTCCA
TAGTTACTGCTCGCCTTGCCAATTATTATCCCGATCGCTTCTTGGGATTCGGTTTCCTGGCTGTTGGTTATTTAC
CCCCAAATCCCACTCACACTTATGAAGACACCCTGGAGCTGGTGAGCCATCGCCTAGTATACAGATCCAAAGAAC
CAATGTCTAACGCCCCCAAAGATGAGAAAGTCATTTGGATCAGAGAGACTTGGTTATCAGTATGGTTTTATGATT
CAACGCTTCATCTTTAGCCTCAAACCAAAACCAGATCTTTTTTTGCTGAACCGGACGGCCATATTTTATGTGAAA
AGAACGTATGTTTGTCTACAGCGAATGCTTGCGAGCTCAAACGATAATAACATCTCTCTTGTAGTTTGACACCTT
TTACAGCATCGTTCACCCCAAGGATTACGGCACCATATGGCCTCAGGCCCTATACAGTTTAGGCGAGACCAGAAA
GTGGATTGAACGCAATGTGCCAGTTGAGATAGAGCCTTCAATTCCAGAAGAAGTATAGATCTACAAAATAAATGC
CACTCGAATCTGTACTGACGCTAGCAATTCAAGGAACATGCGTATAAGAAGGAGCAGCTCAAGAAAAGCGGTCTC
AGAGCAGCCATGAGTTGGTACACAGTTTCGGTCAAAAATCTCGAATTGGAAGAAATTAAACGTGCGCCATTCCAC
ATTCTCCATAATCCTTATCAGGGTGATTTTTCAACAAAACAACAGAAATTCCACAGTCGGCCTACACAATTGAAA
AACCCGTTTTTCTCGGTCTCACAGAGAAAGATCCTCTTTGCCCTCCAGCCATCTCAAAGCCATCAGCAGAGCAGT
TCTGCAAGAATGTTACTATAAAAGTCTTCGATTGTGGTCATTGGATCTTCTGGGAGAAGAGAGACGAGCTCAATA
AAGAGCTCGCTGCTTGGCTAGAGACTTTGGGACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail